SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000010221 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000010221
Domain Number 1 Region: 17-142
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.27e-24
Family Calponin-homology domain, CH-domain 0.00051
Further Details:      
 
Domain Number 2 Region: 996-1109
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000000578
Family PDZ domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000010221   Gene: ENSXETG00000004710   Transcript: ENSXETT00000010221
Sequence length 1690
Comment pep:known scaffold:JGI_4.2:GL172649.1:2232418:2343977:-1 gene:ENSXETG00000004710 transcript:ENSXETT00000010221 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEWNENPEVSCDLAYSEAQRWIEEVTGKNFGNKDFRSALENGVLFCDLINKIKPGIIKKI
NRLSTPIAGLDNINVFLRACETLGLKEAQLFHPGDLQDLSSRVTVRPEETDRRLKNVLIT
LYWLGRKAQSDSYYNGPYLNLKAFEGLLGQTLIKALEESTSSKRSGRDSGCSDLWYSEQR
DSLTSPPIHKRDDSWDSLDSFGSKSYTSFSSDTTIKGSSEGGESETESELTDKMQDSSKD
DMSYRRLSAMEPKATTTFNKFLPNKVKQFNYMPAPLRKKRIDKNEDNRRSWASPVFTEPD
GTFSSQDQKTDGQKQTKTVLKDSFEYSSLTSDEDDDFTRDVPNIVNDDLYVRKVGVPAPQ
SKTSFDMFLPNFSAQEDDQLRKQIRKGMCSRPWYNEFQGFSQFLLLQALQKMSYDALTSK
TKSDPTSGPRVVTSCHKPSNQNEDTMEMLPNLQNDDFFTRKTRTFHLNQVINLGTPLVRV
CEIEKDIICQSKLEDSELPDLVKDDMTIRRVQNEPKEIHLSGAPDNYHPVPFPEPWTLPE
NIQSKFLCTVTKKQESAKEDKCGGVIKMSDKLKKDDMLTRKVNLCQTSNSLTPKSFIPGP
CNDKDFKKWEWIREASKARHKKRLLVERLKEKLSINSGSKSLEAITADELISNRQVRFEE
LQKIRTQLQDQDQKWQDDLAKWKSRRKSFTSDMQKKKEEREELEKISYESPERTYKTFRE
MQQERNSRSKESSEDRKMYSSNDDVFGDAPSKLEAPYSMGKGTSSVQNKENDRGVISELL
PTSNSTFETDGTYSSKANTSYVEQGPENSNTKTSRSLFERTYTVESGAPYSNKKETIHSI
TSYEKQDNGPPMNSSSLLGEQHSYSSFVTESKPIPGLASLPRSYQKNDTSRITSVVTPRP
FGIQSKGITSLPRSFTVDDSFKYNGDLGSTKNNSAFNSYIKVEEKPNRIKRSEENDEPDE
KESIRRSHSPKPFPGVSAAPEKRIISESVNVTSSARGVDQTKVPGRGRAISIADISSFID
QYSDLRISINQKPGSSLDFGFKTSWNSSGVFVKSVDIGSPAEFCQLHVDDEILSVNGTKV
SSMDYNQWVEAMDHAVETGNLAMDVRRYGKNGSPENKWIDDSTPKGIYTIKRIANKSIFW
QSLKMLSITITVCTEVGGSELVACSLFFSQLESESISLKNYKRRSQFFEQGSSDSSLLDM
PVPSINVSTRRSWDPEDERKRQEKWLQEQEQILQEKYKREQEQLREEWERAQQEAEKERF
HQIQQQEQVHSSLPITSQSSYWKTFGSDLHSSEEENRQKESSEEELESERQWKRAEEERL
KYLEAQRHHEVEEQRRQLEEETNRRQTEEENRRRQAEEENRRRQAEENERKRQEEERKRK
EEEMRLQRAAEEERHQKKLQEEEQKQNASERIYGSSRKISTLQLTKSQKYSHGFLPKDEQ
KRKNTKFSQSSVPSELEAKRKQIFNQMKYPERYRVKEQLQGSAEVERQRIIQEMRKKAPL
NNDNSWIRQRSSSMTKEASTLPNYMRRGESLDNLDSTSGLQRVSPWANQSSSYNSLSSSQ
DFSRPSQVVSTSNRTFLRNSSNSLPQSAAGPSKSASLPQSSAVSQTSNQQRNKSVSGKKL
CSYCNNSLGKGAAMIIESLGLCFHLHCFKCVACETDLGGSESGAEVRIRNSELYCNSCYI
KFKMGQPTSM
Download sequence
Identical sequences F7AC24
ENSXETP00000041498 ENSXETP00000010221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]