SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000010574 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000010574
Domain Number 1 Region: 4-207,253-362
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.65e-56
Family Calponin-homology domain, CH-domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000010574   Gene: ENSXETG00000004872   Transcript: ENSXETT00000010574
Sequence length 365
Comment pep:known scaffold:JGI_4.2:GL173626.1:161130:182652:1 gene:ENSXETG00000004872 transcript:ENSXETT00000010574 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSATPVRSPTLQGPKMRKDESFLGKLGGTLVRKKKAKEVSDLQEEGKNAINAPMSPTPID
LHPEDTLLEENEERTMIDPNSKEEAKFKELVKVLIDWINEVLVEERIIVKNLEEDLYDGQ
VLQKLLETLGSRKLNVAEVTQSEIGQKQKLQTVLEAVQELLRPQGWAIRWNVDSIHGKNL
VAILHLLVALAMHFRAPIRLPEHVCVQVVVVKKREGLLQTAHVTEELTTTTEMMMGKFER
DAFDTLFDHAPDKLSVVKKSLITFVNKHLNKLNLEVTELETQFADGVYLVLLMGLLEGYF
VPLHNFYLTPEGFEQKVHNVAFSFELMQDGGLKKPKARPEDIVNLDLKSTLRVLYNLFTK
YKHLD
Download sequence
Identical sequences Q6GLA6
ENSXETP00000010574 NP_001005624.1.99540 ENSXETP00000010574 gi|49250459|gb|AAH74596| gi|54020757|ref|NP_001005624| 8364.ENSXETP00000010574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]