SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000010906 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000010906
Domain Number 1 Region: 3-43
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000493
Family HkH motif-containing C2H2 finger 0.0046
Further Details:      
 
Domain Number 2 Region: 81-117
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000506
Family HkH motif-containing C2H2 finger 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000010906   Gene: ENSXETG00000013525   Transcript: ENSXETT00000010906
Sequence length 156
Comment pep:known scaffold:JGI_4.2:GL172848.1:278592:299432:1 gene:ENSXETG00000013525 transcript:ENSXETT00000010906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SDETEVDKNKCCTLCNMFFTSAIVAESHYQGKTHAKRVKLVLGESPNTAAPAAPSTGTEC
ELHANVPLAAIILSRQREVRKFCDLCRAWFNNPLMAQQHYEGKKHKKNAARAKLLQRLGE
TLDSEALEGKRGIYLLTLCSIQHIHGKASYFNLFNG
Download sequence
Identical sequences L7N2S7
ENSXETP00000010906 ENSXETP00000029630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]