SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000011315 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000011315
Domain Number 1 Region: 48-57,181-420
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.28e-70
Family Eukaryotic proteases 0.00034
Further Details:      
 
Domain Number 2 Region: 81-183
Classification Level Classification E-value
Superfamily SRCR-like 9.02e-16
Family Scavenger receptor cysteine-rich (SRCR) domain 0.084
Further Details:      
 
Domain Number 3 Region: 50-85
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000628
Family LDL receptor-like module 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000011315   Gene: ENSXETG00000025394   Transcript: ENSXETT00000011315
Sequence length 423
Comment pep:novel scaffold:JGI_4.2:GL173673.1:171994:189462:1 gene:ENSXETG00000025394 transcript:ENSXETT00000011315 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YMPPDPIKPSETWFTPRRKKILCIVSSVCVLLAAAIIIAVLCSVYVETKACQMTCGTTGI
CVLYTQWCDGISQCPSGEDEQTCVRLYGPSFQLQAYSPAKATWLPVCYDSWSDNSGKTAC
QDIGYSMSTYLGSSQILASSSNGYVKLKSSTVTGKLYKNLQYSATCTTGTMVSLRCINCG
LSTKVDNRIVGGTFALAGDWPWQISLMKLVGTSLYLCGGSIITPYWIVTAAHCVYGYTSS
PSIFKVFAGSLTLSNYYSAGYLVDRVLIHPSYSPNTQNYDIALLKLKTALVFSNYGSQLH
LMASLQMQNFLLFSYKLTYNTGSISTSLKAASVPIISSATCNLAPVYGGVISPTMICAGY
LGGGTDTCQGDSGGPLVTKTNSLWWLVGDTSWGYGCARAYKPGVYGNITVFLEWIYSQMQ
VTT
Download sequence
Identical sequences F7BQG2
ENSXETP00000011315 ENSXETP00000011315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]