SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000011419 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000011419
Domain Number 1 Region: 1306-1445
Classification Level Classification E-value
Superfamily PRC-barrel domain 2.2e-60
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.0000016
Further Details:      
 
Domain Number 2 Region: 246-336
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000000694
Family Calponin-homology domain, CH-domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000011419   Gene: ENSXETG00000005227   Transcript: ENSXETT00000011419
Sequence length 1451
Comment pep:known scaffold:JGI_4.2:GL172655.1:3660031:3720363:1 gene:ENSXETG00000005227 transcript:ENSXETT00000011419 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDIAEGGQEVKRTFIVPAIKPFDHYDFNRAKAACNLSWLVAKAYGAENVPKELQEPFYT
DQYDQEHVKPPVVNLLLSADLYCRAGSLILKSDTAKPLLGHDAVIQALAQRGLYVTDHEK
LVTERDLRKKPIQMSAHLAMIDTLMMAYTIEMVSIEKVIACVHKYSPFFQTADLPYDIED
AVMYWINKVNGHLKSILEQEQRLKMQQNLDPNTTQKSSSKWFWKLVPARYRKEQNLFKQL
PCIPLMENILKDGTDGCAISALIHFYCPEVIRLEDICFKESMSLADSLYNLQMIQEFCQE
YLNGCCHFTLEDMLYASSSVKTNYLVFMAELFWWFEVVKPSFVQPRVLNPNVAAHKVRTP
SSAPHLNRRNTIGASKKNINSSKISLTLLLFSNVAVIRRSSSMSYVDGQVGTWPKEKRSS
VHGVSFDISFDKEDGMQVTAPSRPISRSISNEGFSLNMARVPKHIRKNLSFQPINGQGID
EEWRQMLPNHNVTSTTSDHWDSDDGEQYKRHNGPVENQIEVDELDSQVEAPTIEEALNII
HNPEKTSVSGNQTNNGFYLHNHDINLGLQLSQPGLTEGNFDLFEETKGTQSPVTDNTEVD
TGIHVPSEDIPLTMDEDSSLKDYTVSLDSDIEDPLKIHQEYGSQIGSVREPVSPCPSSVS
GKSQAGSTASSSSGIKMTSFAEQKFRKLNHGDGRSSGSSSQKTTPEGSELNIPQIVAFGQ
TPDDNTVLQGKDTTQLLASEMVQLRMKLEEKRRAIETQKKKVEAAFTRQRQKMGRTAFLT
VVKKKGDIISPLREEPAGGESDKAPAECEGDSLRISDHFVDNANVKLKVDPNQAKWLMSP
TTPGDPEKPWNLTSPSEENMSEGDILEYTKSIEKLNSSLNFLQQEMQRLALQQGMLMQMR
EKQAWVISPPQPSPQKQLPPQNTTKQTTKPSVTWSPAPCFTIESPRSAHRSPQTSAKKTV
SFPAKTQRIPRPNDLKIAPLNRTLTPPQSVDSLPRLRRFSPSQTQTRSFVYFGDDRKPTT
DSQEDEVSVKEKSDVISDKPAEVKIRPIESTVSEVLSQPIIETVCVTPNDEQFSHRSLSA
SKTGSLIEVPLSKLQPSDEKPEENELEPDKEQNSEDQKVCCGFFFKDDRQEENDMAAKRA
ALLEKRLRREREVQQRKQEQEVELEHKKEEARRKSEEERSKKEDEKARKEFIKQEYLRRK
QLKLMADMDSIIKPRANLGKPRKPRPKSIHRDHQLESPRTPVRAPPAVSSLSLASLNTGD
NESVNSDKRTPRSESVEGYLSPGRCGSRNGEKDWENASTTSSVASATEYTGPKLYKEPSA
KSNKYIIQNALSHCCLAGKVNEGQKNKILEEMEKSNANNFLILFRDAGCQFRSVYTYCQE
MEEINKLTGIGPRSISRKMIDGLYKYNSDRKQFSHIPAKTLSASVDAVTIHSHLWQAKRP
VTPKKLLSPKA
Download sequence
Identical sequences F6VFE3
ENSXETP00000011419 ENSXETP00000011419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]