SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000011952 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000011952
Domain Number 1 Region: 42-539
Classification Level Classification E-value
Superfamily Sema domain 1.7e-178
Family Sema domain 0.0000000000211
Further Details:      
 
Domain Number 2 Region: 535-587
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000349
Family Plexin repeat 0.0023
Further Details:      
 
Domain Number 3 Region: 601-679
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000376
Family V set domains (antibody variable domain-like) 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000011952   Gene: ENSXETG00000005431   Transcript: ENSXETT00000011952
Sequence length 779
Comment pep:known scaffold:JGI_4.2:GL172774.1:1554177:1615880:1 gene:ENSXETG00000005431 transcript:ENSXETT00000011952 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QNIMKEKHQKYLGRWLKPQHSSTMLSMVLLMFLPATDSLKQNIPRLKLSYKDLLLSNSCV
PFLHPLTEGLEFQTLLLDEERGKLLLGAKDHIYLLDLVDLNKNLRKIHWPAAKEKIEFCK
RAGKDNNLECANFIKVLHHYNKTHAYTCGTGAFHPLCGYVELGTPKEEVVFQLDTQNLES
GRLKCPFDPQPPFASIMTDEYLFAGTASDFLGKETTFTRSMGPPPDHHFIKTDTDDHYWL
NGAKFFGAYAIPDTYNPDDDKIYFFFRESSPEGSFSEKSVFSRVGRVCKNDIGGQRSLIN
KWTTFLKARLVCSIPAQDGGDTYFDELQDIFLLPTKDDRNPVVYGIFTTTSSIFKASAVC
VYSMADIRAVFNGPYAHKESPDHRWVQYDGRIPYPRPGTCPSKTYDPTIRSTKDFPDDVI
NFVKNHPLMYKAVYPLHGKPVFTRLNVDYKLTQIAVDHVVAEDGQYDVMFLGTDIGTVLK
VITVTKDIWNMEEVLLEEMQIFKQPAAITNIELSLKQQQLYITSEVGLVQLSLHRCDTYG
KACTDCCLARDPYCAWDGNSCSRYVPTSKRRARRQDVKNGDPLTQCWDVEDNTNQEPAEE
KVIFGIENNSTFLECMPKSQQASIRWFIQHTGEEHQEEITSDERIIKTDYGLLIRSLQKK
DSGMYYCKAQEHTFIHTITKLNVKIIENEQMENTQKLEDDEGRSRDLITESRLRYKDYLQ
LLSSPSFSLDEYCEQMWHKEKKRQRNKGGAKWKHVQEIKKNRNRRHHEQRNQWARILSA
Download sequence
Identical sequences F7EEA0
ENSXETP00000011952 ENSXETP00000011952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]