SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000012836 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000012836
Domain Number 1 Region: 33-511
Classification Level Classification E-value
Superfamily Sema domain 4.71e-145
Family Sema domain 0.0000000937
Further Details:      
 
Domain Number 2 Region: 507-552
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000012
Family Plexin repeat 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000012836   Gene: ENSXETG00000005837   Transcript: ENSXETT00000012836
Sequence length 1011
Comment pep:known scaffold:JGI_4.2:GL172915.1:506362:553779:-1 gene:ENSXETG00000005837 transcript:ENSXETT00000012836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRGVLLLVCTYLSSALVFPKDLTPIRIIETLTTSSYPWFRGLASDDDTAHLGLDFQKMLK
LNQTLFVAARDHVYAIDLRRAKEAIIPDKYVTWKTQDMENCAMRGKLRDECYNYIKVLVP
KNDQTLVACGTNSFNPMCRSYKIKTLEQEGEEFNGQARCPFDAKQANVALFADGNLYSAT
MADFQASDAVIYRSLGEKSPVLRTVKYDSKWLREPHFIHAVEYGNYVYFFFREISMEYTT
IGKVTFSRVGRVCKNDMGGSPRVLEKYWTSFLKARLNCSVPGDSFFYFDVLQSVSDILTI
NNRPAVIGVFGTQANSITGSGVCAYYMDDIEKVFNGKFKEQKTTESAWTPIPEDKVPTPR
PGCCAGYGKAATYKTSNEFPDETLSFIKSYPLLDEAVLSITETPWFTKTTSRFKLTHLAA
DTSAGPYGNYTVLFLGSEDGKVLKVLSGTTENSTVETLLLEDINVYNPAKCNVKKEDRRI
LGLQLDRENHALFVAFSSCIIRVPLSRCELYGTCRRSCLASRDPYCVWLKSGACASYRND
IRGSFEQDIEQSKNWGNCQGMFTVHVLHTISLAAYVVTSSGSVGNEGDSAYGKLIGWQYL
LSAICSDAFFIIRNQGHHSITGVRQEVGSMESSKSVHFTFLIGCVFVAFVVGAIFSGLFV
SCYCNHMFQKNKHVGRDPESSLQRPLSLRSLAKMNGLLESQSKEGRMEPTSPKLYTTLLH
GEKEQTTETTKGESKDHPELSGLPTPESTPELPMKNLKAFKNQWERNQNCNNAKEIQGKS
PVFHFPVSNSQVFQFPSTLVLPTNMHGYDQPLSGYGDDKKIPNSERALIRHSQCYLPKGM
MAISPQAVSPHSPMSFINKVQPKIPDTESAPYYSSSTLPRDSLPRRLDIPPDVTPQSCLE
KQSRSQRHSLSSGHKLMNIGPGGPILSRQHSLGQGNRQHPPPPLLTRMHSTGTPVPMESH
SVFLSRQLSYQEQTPMSRSMVKRTLSLRPDVPSNSVFLPSSPSLVAKDTCS
Download sequence
Identical sequences F6R1W7
ENSXETP00000012836 ENSXETP00000012836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]