SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000013097 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000013097
Domain Number 1 Region: 177-222
Classification Level Classification E-value
Superfamily SRCR-like 0.00000000000209
Family Hepsin, N-terminal domain 0.03
Further Details:      
 
Domain Number 2 Region: 147-179
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000128
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number 3 Region: 104-135
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000196
Family LDL receptor-like module 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000013097   Gene: ENSXETG00000027107   Transcript: ENSXETT00000013097
Sequence length 229
Comment pep:novel scaffold:JGI_4.2:GL172851.1:1509527:1516893:1 gene:ENSXETG00000027107 transcript:ENSXETT00000013097 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEANLSVIPPNKNNYEYPAPPPYESLPLAVPMRPVPPPPPYSPEEPTGQSGAAPPTSTSS
WSRRKKICVTSTAIAVKVVIIVAIILARTLVPRYIKHSSPPTCQMYCSFSSNCIYPNQIC
NGIADCPYGDDEQNCGHLIFPSLPTCQMFCSDSFICINANQICDGVPDCPYGDDEENCVR
LYGADSQLQVYSTLKSAWLPVCADNWTDAYGRFACQDIGYSGTNIQAIV
Download sequence
Identical sequences F7EDG7
ENSXETP00000013097 ENSXETP00000013097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]