SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000013099 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000013099
Domain Number 1 Region: 420-671
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.56e-78
Family Eukaryotic proteases 0.00025
Further Details:      
 
Domain Number 2 Region: 331-394
Classification Level Classification E-value
Superfamily SRCR-like 0.00000000000109
Family Hepsin, N-terminal domain 0.029
Further Details:      
 
Domain Number 3 Region: 302-333
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000236
Family LDL receptor-like module 0.0035
Further Details:      
 
Domain Number 4 Region: 208-244
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000589
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 5 Region: 122-158
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000681
Family LDL receptor-like module 0.0037
Further Details:      
 
Domain Number 6 Region: 75-112
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000144
Family LDL receptor-like module 0.0039
Further Details:      
 
Domain Number 7 Region: 4-41
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000196
Family LDL receptor-like module 0.004
Further Details:      
 
Domain Number 8 Region: 259-293
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000249
Family LDL receptor-like module 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000013099   Gene: ENSXETG00000027108   Transcript: ENSXETT00000013099
Sequence length 676
Comment pep:novel scaffold:JGI_4.2:GL172851.1:1431074:1498606:1 gene:ENSXETG00000027108 transcript:ENSXETT00000013099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSCQNLCSYSSNCFYPNQICDGIADCPYGDDEKNCDTYLVKMSGATTVLYYYSITMGLLL
CEINSKSFFTETSIQTNPTCQMYCSYTYTCIHAYQICNGVQDCLYGDDERNCDTEIVTWP
PCIMFCSYGPNTKRCIVAYEICDGIRHCPDGDDELNCAWGTPTLTTCSPYHSYPYLCVFT
LIICCSILYCPTGSESEYGMVIPTTSPPTCQVYCSFSFSCISSSQICDGVGDCLFGDDEE
NCEIFFTFTGPQMLPTFPTCQFCSFSSNCIRANQICNGIADCPYGDDEENCATQISLPSC
PMYCISTFMCISAKQICNGIADCPYGDDEENCVRLYGADSQLQVYSTLKSAWLPVCADNW
TDAYGRLACQDIGYNGSSYNRSDTMNSTYAPNGYFQLKNGSQTSKLYSSIEHSDEYIFST
VLIPLPIGCGVSYNSVASHKVGGTKAASGNWPWHVGLRYKTGLLCGGSIISPKWIVTAAH
CVYGSYSNASGWKVFAGALTQPSYSDANGYSVERIIVFPGYNSSDNDNDIALMKLTNDIK
FSYTTQPVCLPNVGMFWEAGTQCWISGWNTTSQGGNISTTLQYAEVQLVPSHVCNQSHVY
NGSITPSMLCADARHGRIGSCQGDGGGPLVTETNGTWWLVGETSWGVGCAQPNKPGVYGN
MTSFLGWIYLQMRVRN
Download sequence
Identical sequences F7EDF3
ENSXETP00000013099 ENSXETP00000013099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]