SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000014232 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000014232
Domain Number 1 Region: 94-137
Classification Level Classification E-value
Superfamily LysM domain 0.000000249
Family LysM domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000014232   Gene: ENSXETG00000006499   Transcript: ENSXETT00000014232
Sequence length 869
Comment pep:known_by_projection scaffold:JGI_4.2:GL172639.1:2604169:2719134:1 gene:ENSXETG00000006499 transcript:ENSXETT00000014232 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSCFRLKKKSQSVDIAASGYNPLSDASAPQASRVPPPIVKAISEEEHHNTTNAQKRHLRR
GDLKRGYTIDTGQKKTLEKKDGRRMSFQRPKGTMEYTVETRDSLNSIALKFDTTPNELVQ
LNKLFSRAVVPGQVIYCWFAYRTLSVHLPVEQSKLYDLSLCLNLSCLSAVADTERMPYKE
ITSSPAYSAIRPSRVVSSTSEEEEAFTEKFLKINCKYITDGKGTVNGVLLVTPNNIMFDP
HKNDLLVQEKGCEEYGIMCPMEEVTSAAMYKEIVNSKLKDSVSVDVGQLSCMREFCHLKK
ISPGNLHDIDSQMWDAGNDSASTAPRSTEESLSEDVFTESELSPIREEHLSSDELRQDKS
SGASSESVQTINQNITECSLNISDCVSASDDVKDSLEPSGNDSGIVASINDLEKSEASIN
AGEGVDKDISESSLILTEAIEGHNSNDGILSSNKDKQTGDQNHSREAAFVRNHQHETVQE
EAVKQSFGDSETEAEELRKFWKDLTMQQAKQQREDMQHTTQKEIMGKMPTAETHIEGVCS
SVAKEKRRHRSHRYLCLRVGKPMRKTFVSQASASMQQYAQRDKLEYWFAVPHERSDHLYS
FFIQWSPELYAEEVRESAREPGFVVVKKNEETEGSDCSTNDSAARLWEVVSVAEYHRRID
ALNTEELRTLCRRLKITTREDVNSKQATNIKNDQEPESFRPNLSDPSSLLQTDQIEKLTK
HLPPRTIGYPWTLVYSTAKHGMSLKTLYRTMLGLDTPVLLVIKDSDAQIFGALASEPFKI
SDCFYGTGETFLFTFCPDFEVFKWTGDNMFFIKGDMDSLAFGGGGGEFALWLDGDLYHGR
SHTCKTFGNCILSKKEDFIVQDIEIWAFE
Download sequence
Identical sequences F6VMD6
ENSXETP00000014232 ENSXETP00000014229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]