SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000014747 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000014747
Domain Number 1 Region: 878-983
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.4e-31
Family Calponin-homology domain, CH-domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000014747   Gene: ENSXETG00000006748   Transcript: ENSXETT00000014747
Sequence length 985
Comment pep:known scaffold:JGI_4.2:GL173059.1:390390:480888:-1 gene:ENSXETG00000006748 transcript:ENSXETT00000014747 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GTSAAARRTGIPAPRELSTPVSRDRVALRSPVNANAKKTLPSPSSPSTPTPSKNVRTPTR
PKQENEQINKTVLEIQVKELLAEAKTKDSEICKLRSELQKCKDKESPSPEVLNSIGPLAE
LHDINNVALSDPEALIRTLQEKNTNSLLELAILRKENADLKQKLHALEQSPLSDTITSNG
TDSSSLLSPSTQGTNIGCQLKSPPAGETGDCRIPGSESGLHISGSSSSDVTKASISPDAS
DFEHIADMPSRPTSTGSIPCQGSKCSTSGSSPNNISDLSVASLTERIHKMEENHHSTAEE
LQATLQELSDQNLMVQELTMESEKLVEEKAFLETNLQQQRQRAEQLSQENERLMGLLKDR
AKTEEAEIHGKLTETEKKYLELVEKSQFEREKLLNIQQQLTSSLRSLEKEHQEAQAMRKK
LEEEVDKLQRLLDTQRKEKNVTAKALEDQKVTNEGLKIENNCLKAQLEGERQKAAEITAV
GKGSGSGNTEIQEMLKSAHAEKEHLELTCSELRQELLRANSEVKQLQCLLAKVETECHDL
KELGDLREEQLKSANLKLQERSSEKDTEIKDMKETIFELEDQVEQHRAVKLHNNQLISDL
ENKVDKLEEQKQDLERQLKLLNKQMKEDAEEWRRFQADLQTAVVVANDIKCESQQELRAV
KRRLQEEEERSACLHRELEELQGSSGRAIILRCVTPPLKKGEVESVDEDNRIRWPSVAHT
QAPTSSSELPATVKSLIKSFDLGNQGGVGQNIPVHSVPRSPLSGIPVRTAPAAAVSPIQQ
RKEHNVYSISAINPSSSSSCSQLNVNILELVDKLKGQRDDFTPDRFPRKSPSLESLNTHT
ALGFGSRTSPIALDSLSHHSKISVERKDPLAALAREYGGSKRNALLKWCQKKTEGYSNID
ITNFSSSWSDGLAFCALLHTYLPAHIPYQELNSQDKKRNLMLAFQAAESVGIKTSLELNE
MMFTDRPDWQCVMHYVAQIYKYFET
Download sequence
Identical sequences F6WBT6
ENSXETP00000014747 ENSXETP00000014747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]