SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000014789 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000014789
Domain Number 1 Region: 106-136
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000412
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 2 Region: 45-93
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000471
Family TSP-1 type 1 repeat 0.0051
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000014789
Domain Number - Region: 502-546
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000148
Family EGF-type module 0.045
Further Details:      
 
Domain Number - Region: 550-596
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000863
Family TSP-1 type 1 repeat 0.0014
Further Details:      
 
Domain Number - Region: 169-240
Classification Level Classification E-value
Superfamily L-aspartase-like 0.0706
Family L-aspartase/fumarase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000014789   Gene: ENSXETG00000006766   Transcript: ENSXETT00000014789
Sequence length 598
Comment pep:known scaffold:JGI_4.2:GL173054.1:933962:952518:1 gene:ENSXETG00000006766 transcript:ENSXETT00000014789 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSAGRMANIHLILAITTLCAFVSGEPSFSQTPKRLQREVNAPAPIDCQLSSWGSWSRCDP
CTKHRYRSRSIERFGQYGGAPCVNTLGDIQRCIPEEDCMEPPVFCGNDFECESGRCIKAR
LLCNGDNDCGDYSDETCDDKDPKPPCRNMEIELSEIARTAGDGLNILGMKPKRNPFDNEY
FNGICDRVRDGKTYFRKPWNVAALVYKTRADKSFTTETYHDAKSVMSKIIEGLTVNVDAS
LSLKMTPTEQKNLTVGASAGLGYSKNKSVQRLRQYSETKDKTYMRVSGTVQLASFQMRTR
GAMLSPTFIEDIKSLPRDYDKAEYFSILEMYGTHYTVSGTVGGKYDLVYVLDSIVMKSLD
ITTEDVTDCLKLNAGANIGGTENGAKVDVNPNVKTDICNKGGGETETEPRRTQKPVIESI
ISFVDGGSVEYVTALEEKLNKKEPVADVDDYIQWASSLKDSPTVINSKSNPIISLIPTDI
KDAYIKTRNLERAIEEYLDEHSVCKCQPCQNGGKVMVIDGECICKCTLHYEGVACQNIKS
DLFSTPKQPIDGGWGCWTISPNCVDGEMIATRKCDNPVPQEGGKPCHGQQTKKIPCEK
Download sequence
Identical sequences F6VKE9
ENSXETP00000014789 ENSXETP00000014789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]