SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000015078 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000015078
Domain Number 1 Region: 209-323
Classification Level Classification E-value
Superfamily Immunoglobulin 9.11e-21
Family V set domains (antibody variable domain-like) 0.00053
Further Details:      
 
Domain Number 2 Region: 2-107
Classification Level Classification E-value
Superfamily Immunoglobulin 1.85e-18
Family V set domains (antibody variable domain-like) 0.001
Further Details:      
 
Domain Number 3 Region: 75-180
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000413
Family C1 set domains (antibody constant domain-like) 0.074
Further Details:      
 
Domain Number 4 Region: 329-391
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000239
Family C1 set domains (antibody constant domain-like) 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000015078   Gene: ENSXETG00000006889   Transcript: ENSXETT00000015078
Sequence length 392
Comment pep:novel scaffold:JGI_4.2:GL174020.1:45947:68553:1 gene:ENSXETG00000006889 transcript:ENSXETT00000015078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGSDVLLPCTLTPEKNGEKMEIRWFKKIFQPYVHLYINGKDDYTAQMPQFANRTELLKEN
ITRGIFPLKIHKVTAEDSGEYYCYVESSDHHSMAAVQLQVTAVGTVPVISITNDNVSCES
RDWNPKPHLTWTDNEGNKINSSMVEVLRDENNLYYILSIIQQPSASNITCTVSNSINHCS
DTRQIRGVKVSEKLYIIWFSISVYPHRSSPPPLSVALGSDVLLPCTLTPEKNGEKMEIRW
FRFRYQPYVHLYINGKDDYTAQMPQFANRTELLKENITRGIFPLIIRNVTAQDSGEYHCY
VESSDHHGMAAVQLQVTAIGTVPVISINNDTISCESRDWNPKPHLTWTDNEGNEINSSMV
EVFRNENHLYNILSIIQQPNASYITCTVSNSI
Download sequence
Identical sequences L7N2Y2
ENSXETP00000015078 ENSXETP00000015078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]