SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000015621 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000015621
Domain Number 1 Region: 25-516
Classification Level Classification E-value
Superfamily Sema domain 1.31e-172
Family Sema domain 0.000000000182
Further Details:      
 
Domain Number 2 Region: 512-563
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000349
Family Plexin repeat 0.0018
Further Details:      
 
Domain Number 3 Region: 580-661
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000742
Family I set domains 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000015621   Gene: ENSXETG00000007179   Transcript: ENSXETT00000015621
Sequence length 697
Comment pep:known scaffold:JGI_4.2:GL173326.1:326001:365435:-1 gene:ENSXETG00000007179 transcript:ENSXETT00000015621 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLVSALPPLLLLLLNLPPCVRTTRPPRVYLSYRDLMESRSARSFTFGFNTSDYRILLLDQ
DQDRMYVGSRDYVLSLDLGNINREPLIIHWPAPLNRHKECLMAGRGRVDECYNYLRVIQP
LNRTHLYACGTGAYQPQCAVIYRGWRSEDYVFRIVPASLESGKGRCPYDPKQENMATLID
GVLYAGVQVDYMGTDSAIFRTMGHKPPIRTEQYDSRWLNDPLFVGSLVVSESSFKEDDKL
YILFRERSLEGENGPALVSRIARVCLNDEGGLRSLVGKWTSYLKARLVCSVIGQDGVETS
FDQLRDVFIQPTHDKQNPLIYGVFTTLGSVFRGSAVCVYSLADVRAVFNGPFAHKEGHGY
QMTAYSGKTPYPRPGACAGGFSVPRNRSSRNFGEDVLRFVRTHPLMYSSVYPVNRRPLLL
LSDASYTYTSIAVDRVPAADGEYTVLFLGTDRGTVQKVMILPRGTKETESITLEEVEVFK
VPSPIRNLRISSKRHQLYVSSDVGVTQLSLHRCGRYGDSCADCCLARDPYCAWDGKGCVR
YTPSPSRRSRRQDVKHGDPLRQCRGYNTQVDRGIAERLQISVEGGSAYLQCDTHSPLESV
TWLLQRDGSQHRREAKVRLSAIDGGAVLRSVQASDAGVYTCTGTENGFRRSRAKIRLNVL
PRDLLEKLTAAPTLAPMAAQCPPPRRPRPRPSHTDRN
Download sequence
Identical sequences F6RA36
ENSXETP00000015621 8364.ENSXETP00000015621 ENSXETP00000015621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]