SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000015639 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000015639
Domain Number 1 Region: 23-205
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.9e-49
Family Tpt1/KptA 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000015639   Gene: ENSXETG00000007196   Transcript: ENSXETT00000015639
Sequence length 228
Comment pep:known scaffold:JGI_4.2:GL173221.1:243672:254869:-1 gene:ENSXETG00000007196 transcript:ENSXETT00000015639 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRSNPSSRRRGSHGKKQDPDVHLSKCLSYALRHGAVNLGLPMGTDGFVPVSSLLLLPQF
RTFSQVDIERVVSCNDKQRFTLRYSYADGALEIRANQGHSLQVEVELTPLGEELPNQAIH
GTYFRHWPSIQQRGLSRMNRTHIHLCTELPGEGQECISGMRRDCEVAIFIDLPKAVADGL
LFFWSSNRVLLTPGNADGLLLPKYFLRALQLRPQRQMIPLEYSRDKET
Download sequence
Identical sequences F7C4I0
ENSXETP00000015639 gi|301621875|gb|XP_002940273| XP_002940273.1.99540 XP_004913701.2.99540 XP_004913702.2.99540 XP_004913703.2.99540 XP_012817805.1.99540 XP_012817807.1.99540 XP_012817808.1.99540 XP_017948910.1.99540 ENSXETP00000015639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]