SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000015718 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000015718
Domain Number 1 Region: 22-145,176-282
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.8e-72
Family Calponin-homology domain, CH-domain 0.0000397
Further Details:      
 
Domain Number 2 Region: 540-668
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000662
Family Spectrin repeat 0.019
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000015718
Domain Number - Region: 1699-1789
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00011
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number - Region: 1100-1201
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00254
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number - Region: 789-938
Classification Level Classification E-value
Superfamily Spectrin repeat 0.015
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number - Region: 2060-2213
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0612
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number - Region: 1797-1905
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0748
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number - Region: 1622-1726
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0767
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000015718   Gene: ENSXETG00000007227   Transcript: ENSXETT00000015718
Sequence length 2258
Comment pep:known scaffold:JGI_4.2:GL172703.1:3198144:3278475:-1 gene:ENSXETG00000007227 transcript:ENSXETT00000015718 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSESESPSSPGEDQQMLRIDERHQVLQAEQEGTQKRTFTNWVNSQLSKHPCPSVLRDLF
TDIQDGHRLLDLLEILSGEDLPREKGNNVFQATNNINTALSYLEQRSIKLINIHAADIIS
GKPSIVLGLIWKIILHFHIESLADILAATDSVHQSKSESKVVPSPTASPPAKRSAKSRWK
SSARKVLLQWANEQCAGHGSLSVTDFKSSWKNGLAFLAIIQSLRPEIVDMDKLKGKSSEE
NLQEAFRLAEQELKIPRLLEPKDVNVPNPDEKSIMTYVAQFLQYANSAEAPKKDVQEQVK
KTIEWLNLEEQKVKKLFSEMKTETYTKKYQEMLLFMRKFNEQKRTFMSGLELKSLPSNEQ
QLIRQSLENITSQIAEWKKQLDLSLPSPLSDVESWLLKGEDLMSHKILDTETHNKAVSLL
QNSSASFKELLASADSHSQTLQTFKNLDDNGFVLVPTDKIEEMKLRLEKITAADFSLMLD
YRCSGHSILALLDEGRPKLKTWNTKCKTQGMAESLLADWKEFVEDMAFLIRLDAAFQNFV
ELKDKLLAAYFIVDDSDISKEYKIIKMKYNEFVDLVHLASSNLEKLLSTWTHYENNFDLI
RGWLEEQGRIAPTKVPSEILSKWKSVHASLNTDAKFLREQLHEKTGLQISAELKHFNTQW
AQFVKRHEKIKPMKKLNGTHLEPSDGKHEKKLTEPLLISADSLKILIENLQEQEENAALQ
QVCKQICSRVEKIDSLIDSAAQWPPTAEIFFQSIDQLKLMDGSLTNKLQNLYAQGTICQK
HLSMAEKDLKAVQQVIRSHDELKHFKTDGIQEKLALIQQQVQELMSRSGSTLTSSELHLS
ESDIKNKFESSKSKLETYITSAMCLMEQRITPEEFISQYENTLSGFDNHNLDEFLKAADE
MKRISSAHEKSVVDKLSVDLRSQWKIIHTEMESYVFRLKLHSEKKKCDDLFCEAEERLRI
EEERVGLGDREDLIRQHKTQRIFSEDGCLGQLCRCLQAMELLLATPRNTEDNSAAQAIIS
ECTRKKAEIEKRAGNIYLHLLSPQGTCRITEKENKSVGLENGLKTTTCKSTGTYASQEIV
ETDSGWIPYEESNTNLSFVLHRYDQEESNLEQFLHCCRQTFTTDNVMNSQDVSSLQTRLH
ELQLLQSQANTYWRCFETLSCDAEKLLDIPNNITLCEKRAELQSNMEIMKEEMQSRIQLL
SVTLHVLLPVQQEVDLLCQSNKSDQELEKFTVSNIDSTCQELKDARNTVEDRLQQIDILE
SASQSGKKLNHVAMEAVESIKAELESTCETMREKEIILKALERFLSSLEATRVSIVAQAN
VWGMDKATLEEKQKNLTVLENKIFHLNQEALQLDDHLQGVEISLEEPEHGGETSCQKLIA
GFPDKVESAKQAVLQELNNLHQKVEAGAIFPAEVALPVQKEVTLARESSQLSQEQTLQQI
TLLNMDSVLQEIKDVQSSVEDEIRKCEDLQTSAELCESLSPVDFQEFHSTLYDFKANLKE
TNKDVKEREAVLKVLKKFLFSLKTAKLNIEEQSVVLERDRPALEDKQTNLTILEKEVFRL
EQEAQLLDGSLEMAGVYLEDPVSGGKTSCQDLIGGFSERVGSAKENILQELRNLQWREDL
EKLAVRQKELCKCVQDIYDKVDQIGLSDPTIHSVQQRLKHLDELEKELDSHVNEKMDISK
GLTDLLQIAQGKDFIGDEDTETLWEDARQHIIYCKEQCEKVMELLRKFQKCKATLSSLIH
KGEITVSQQSSYMGKENVHKKLTEVDAVKQEFNEHSENIDELSSICKKLQFHLSRMKSCG
NPPFQDEAHMIVDKWLDANEKLDSYSDNLKSASCLWNKILQLSEDIDQWAECKIKYCKGS
VLTEHDVLSLKAELQLHVEKIEDVSAKSFQIQKILELSDPPLELQVIKTSLLKKMDQIHE
YSGREPGGDNHGSQSMKGLKENESTQVDAPHSNGLFWDNADKTEDFESLGNALKNGAMEG
ELEDQQTDVQVYAMSSDTTAVLQRASHQKGSETSIPNKGIEALRLQLSDLMKRKEYLFSN
LQPGLQEKVEQLESFTCFLQEVNDFSDTLAALKPKDSTAALDSGVDEWADIQYVHKHLIK
QLQDTRQILENQVHRHEQYEVLITTLNSKMAGFSQELLNFTGSSWESAAGEQRRQKLQKL
HVWIREMDTDLMQILELAEQVKQSTSAPGVKGIQEATRKFQIKIGDLEKKLQSLKHDRSS
PPSLKGNKEILAQMAPEAVLPIQIDSVTAVTKVGKGRK
Download sequence
Identical sequences F6WP71
ENSXETP00000015718 ENSXETP00000015718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]