SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000015948 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000015948
Domain Number 1 Region: 27-517
Classification Level Classification E-value
Superfamily Sema domain 2.49e-181
Family Sema domain 0.00000000000785
Further Details:      
 
Domain Number 2 Region: 513-564
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000384
Family Plexin repeat 0.0021
Further Details:      
 
Domain Number 3 Region: 570-662
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000385
Family I set domains 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000015948   Gene: ENSXETG00000007320   Transcript: ENSXETT00000015948
Sequence length 773
Comment pep:known scaffold:JGI_4.2:GL172795.1:1448494:1473738:-1 gene:ENSXETG00000007320 transcript:ENSXETT00000015948 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLQRSLLSLCLLLYFGLIGSNKVTPRLKLSYQDLMSLHGLRTFTLERSCCYDALFLDEE
RGRLFVGGKNYLMSLSLDNISKQELAIHWPAPVEWREECNWAGKDINIDCMNYVKILQPY
NRTHLFTCGTGAFHPTCGFVHVGQRTDDTVFKMDLRRMEDGKGRCPYDPKHIAAAVLVGD
ELYSGVATDLMGRDFTIFRSLGRRPPLRTEQHDSRWLNEPKFVKVFWIPESENPDDDKIY
FFFKETPVEGAGGVKQSYARIGQICRNDLGGQRSLVNKWTTFLKARLVCSVPGNEIGGDT
HFDELRDVFLLQTRDRRNPLIYALFSTSSSVFRGSAICVYTMNDVRRAFLGPFAHKEGPN
YQWVSYQGKVPYPRPGMCPSKTFGSFESTKSFPDDVLQFARNHPLMFNPVVPGSGRPVFL
RSHGDLSFTQLAVDRVAAADGEYDVMFIGTDVGSVLKVISVPKQSWHHVEQVVLEELQVF
KNASPITTMQISSKRQQIYVGSASGISQLPLHRCGIYGKACAECCLARDPYCAWDGASCT
RFLPNTKRRSRRQDVRNGDPNTLCSGEQQRFSVQEKRLLGVEGSSIFLECLPKSLRAQVT
WTYQKAPESSRTEVQFDERVLQTDRGIVVRNVLRRDAGTFICYSSEHGFTQTLLRLHLEV
IPSSRTEEHLGLQRVPHNRWYQDFMRLVQQPGSVEQMCEEIWTRKGRTSHPPGPQGAPHV
PGSQGRSLPAVPPLNIKTKAQKWKHLEDKRKVRSRRTHEQLSRAERGPRSAPS
Download sequence
Identical sequences F6WNG3
ENSXETP00000015948 XP_012819783.1.99540 ENSXETP00000015948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]