SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000016051 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000016051
Domain Number 1 Region: 191-395
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.41e-52
Family DBL homology domain (DH-domain) 0.000000186
Further Details:      
 
Domain Number 2 Region: 2-230
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.96e-37
Family Calponin-homology domain, CH-domain 0.0029
Further Details:      
 
Domain Number 3 Region: 382-544
Classification Level Classification E-value
Superfamily PH domain-like 7.68e-33
Family Pleckstrin-homology domain (PH domain) 0.0062
Further Details:      
 
Domain Number 4 Region: 671-767,815-841
Classification Level Classification E-value
Superfamily SH2 domain 7.36e-26
Family SH2 domain 0.00086
Further Details:      
 
Domain Number 5 Region: 598-680
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000328
Family SH3-domain 0.00012
Further Details:      
 
Domain Number 6 Region: 786-829
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000554
Family SH3-domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000016051   Gene: ENSXETG00000007366   Transcript: ENSXETT00000016051
Sequence length 849
Comment pep:known scaffold:JGI_4.2:GL173188.1:14280:56251:-1 gene:ENSXETG00000007366 transcript:ENSXETT00000016051 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELWRHCARWLIQCRVLPPNHRVTLDTAQVCDLAQALRDGVLLCQLLNNLMPNAVNLSEI
NLRPQMSQFLCLKNIRTFLSTCSEKFKMRRADLFEAFDLFDVRDFGKVIDTLSILSWTSV
AQNRGYEPFPTEELETDDDIYSGLSDQIDDTGEEDEDLYDCVDMEEEEGNEIYEDLMKLE
EQPAAPTDGKMTSDDMRRCCLQELYQTEEKYTDTLESITQYFMKPLQMFLSQNETNSIFI
NIKELLALHQVFLSEMKSCALYKSQQNLYQVFLRNKEKFLIYGTYCSQVESATKHLEKTS
MEHEGVRMKLEECSQRANNGRFSLRDLLMVPMQRVLKYHLLLQELVKHTVDPTEKDNLKL
SLDAMRDLAQCVNEVKRDNETLKQITNFQLSIENLTDSLAQYGRPKTDGELKVTTMERKS
KLDRYAFLLDRALLICKRKGDTFDLKEFIKLQNFQIRDDSSGDKDNKKWSHMFLLIDARG
TLGYELYFKTRELKKKWMEQFEMALSNIYPDNALANGHDFQMFSFEDTATCKACQMLLRG
LFFQGYRCCRCKAPAHKECLGRVPCCGKQGSAEYIGTILIKDNQKPGRGNNNKRNETGLT
KMEACQEYVGIPPPPIAFGPPLRMEKGVIVELTKAEADQHWWEGRNTSSNEIGFFPCSHV
KPYVCNPVPDLSVYTWYAGPMERRDAEVLLANRSDGTYLVRQRVKDAGEFAISIKFNQEV
KHMKVTSQGGLWRLTEKKGFKGLTDLIVYYQQNSLKDCFKLLDTMLQNPFKEPEKKDNPK
TEKRMKYFGSARARYDFCARDRTELSLKEGDVIRILSKKGQNGWWKGEVYGKVGWFPANY
VEDDFSEYC
Download sequence
Identical sequences F6XSC8
ENSXETP00000016051 ENSXETP00000016051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]