SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000016058 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000016058
Domain Number 1 Region: 2-170
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.75e-61
Family Calponin-homology domain, CH-domain 0.0000102
Further Details:      
 
Domain Number 2 Region: 1410-1600
Classification Level Classification E-value
Superfamily Plakin repeat 4.84e-38
Family Plakin repeat 0.00015
Further Details:      
 
Domain Number 3 Region: 1607-1781
Classification Level Classification E-value
Superfamily Plakin repeat 6.54e-37
Family Plakin repeat 0.00086
Further Details:      
 
Domain Number 4 Region: 5719-5875
Classification Level Classification E-value
Superfamily Spectrin repeat 4.6e-29
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 5 Region: 4841-5001
Classification Level Classification E-value
Superfamily Spectrin repeat 1.65e-25
Family Spectrin repeat 0.005
Further Details:      
 
Domain Number 6 Region: 6172-6304
Classification Level Classification E-value
Superfamily Spectrin repeat 1.96e-24
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 7 Region: 4952-5098
Classification Level Classification E-value
Superfamily Spectrin repeat 4.19e-24
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 8 Region: 5958-6095
Classification Level Classification E-value
Superfamily Spectrin repeat 1.02e-22
Family Spectrin repeat 0.0041
Further Details:      
 
Domain Number 9 Region: 4406-4556
Classification Level Classification E-value
Superfamily Spectrin repeat 6.27e-22
Family Spectrin repeat 0.0028
Further Details:      
 
Domain Number 10 Region: 6307-6424
Classification Level Classification E-value
Superfamily Spectrin repeat 6.94e-22
Family Spectrin repeat 0.0084
Further Details:      
 
Domain Number 11 Region: 186-302
Classification Level Classification E-value
Superfamily Spectrin repeat 2.36e-21
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 12 Region: 5277-5417
Classification Level Classification E-value
Superfamily Spectrin repeat 4.19e-21
Family Spectrin repeat 0.0041
Further Details:      
 
Domain Number 13 Region: 6093-6206
Classification Level Classification E-value
Superfamily Spectrin repeat 4.71e-21
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 14 Region: 6373-6555
Classification Level Classification E-value
Superfamily Spectrin repeat 4.92e-21
Family Spectrin repeat 0.0059
Further Details:      
 
Domain Number 15 Region: 5516-5656
Classification Level Classification E-value
Superfamily Spectrin repeat 2.4e-20
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 16 Region: 6664-6744
Classification Level Classification E-value
Superfamily GAS2 domain-like 3.01e-20
Family GAS2 domain 0.00055
Further Details:      
 
Domain Number 17 Region: 5170-5316
Classification Level Classification E-value
Superfamily Spectrin repeat 1.22e-17
Family Spectrin repeat 0.0064
Further Details:      
 
Domain Number 18 Region: 4073-4197
Classification Level Classification E-value
Superfamily Spectrin repeat 2.64e-17
Family Spectrin repeat 0.0052
Further Details:      
 
Domain Number 19 Region: 1100-1227,1254-1280
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-16
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 20 Region: 5841-5960
Classification Level Classification E-value
Superfamily Spectrin repeat 1.7e-16
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 21 Region: 6575-6655
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000018
Family Polcalcin 0.054
Further Details:      
 
Domain Number 22 Region: 523-655
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000785
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 23 Region: 4624-4779
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000115
Family Spectrin repeat 0.017
Further Details:      
 
Domain Number 24 Region: 4298-4417
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000009
Family Spectrin repeat 0.0061
Further Details:      
 
Domain Number 25 Region: 5432-5546
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000446
Family Spectrin repeat 0.0067
Further Details:      
 
Domain Number 26 Region: 3518-3627
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000115
Family Spectrin repeat 0.0065
Further Details:      
 
Domain Number 27 Region: 3639-3760
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000288
Family Spectrin repeat 0.0038
Further Details:      
 
Domain Number 28 Region: 3382-3509
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000129
Family Spectrin repeat 0.0038
Further Details:      
 
Domain Number 29 Region: 3980-4090
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000177
Family Spectrin repeat 0.0052
Further Details:      
 
Domain Number 30 Region: 3845-3946
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000157
Family Spectrin repeat 0.008
Further Details:      
 
Domain Number 31 Region: 3153-3270
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000249
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 32 Region: 2124-2207
Classification Level Classification E-value
Superfamily Plakin repeat 0.00000000392
Family Plakin repeat 0.0036
Further Details:      
 
Domain Number 33 Region: 4204-4326
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000273
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 34 Region: 463-553
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000236
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number 35 Region: 3723-3840
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000811
Family Spectrin repeat 0.013
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000016058
Domain Number - Region: 2985-3138
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00157
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number - Region: 920-1031
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0112
Family Spectrin repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000016058   Gene: ENSXETG00000007367   Transcript: ENSXETT00000016058
Sequence length 6958
Comment pep:known scaffold:JGI_4.2:GL173188.1:59541:189952:-1 gene:ENSXETG00000007367 transcript:ENSXETT00000016058 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PREKGRMRFHRLQNVQIALDFLKQRQVKLVNIRNDDITDGNPKLTLGLIWTIILHFQISD
IYVSGESGDMSAKEKLLLWTQKVTAGYTGIKCTNFSSCWSDGKMFNAIIHRYRPDLVDMQ
KVELQGNRENLEQAFEIAESLGVTRLLDSEDVDVASPDEKSVITYVSSIYDAFPKVPEGA
EGISATEVDSRWLEYQERVVCLTQWIRQHVLLMSDKSFPQNPVELKALYNQYVHVKETEI
PAKEQEKEQIQKLYQMLQAWIEFGRIKLPPSFHPNDVEEQWGKLILSMLEREKILRPAVE
RLELLLQIANRIQNGCLSCEEKLTLARNTLQSDAANIECGQTFQQESEVVQFLQESEVLL
RQLQSDVQILRDEKYFQVEELAFRVLRIQDELLNLKMECTNLYRRGNLITSDLQPTVSLS
NTHQHSLHTSPSSSSWFRKPMSRTELVVLSSSEDEGSLRFVYELLAWVEEMQMKLEISEW
GSDLPSVEAQLESQRIVHTSVEELTSSLREARSYEVKMSHNFRSSYSETLSKLETQYCKL
RETSSSRLHNLQSLHDFVSQATAQIIWLNQKEEEELAYDWSDGNPNIAAKKEYFTELMQE
LEEKQDVIQALQETAELLSLENHPAKQTVEAYSAAVVSQWQWVKQLCLCVEQHLKENTAY
FQFFNDVRESEVYLNNLQDSIKRKYSCDRTTSINRLEDILQDSMDEKEQLIQSRSSVASL
VGRSKNIVQLKPRNPELTLANTLPIKAVCDYRQIEITIGRNEECVLEDNTQRTKWKVIST
TGNEAMVPSVCFLIPPPNQEAMEMASRVEQLYQKVMSLWHQLHINTKSLISWNYLRKDVE
VVQSWNAEKLKVLPLAERLETLSNLSASLKCHLDEFLEDSKDSQIFSMTDRLNMEQEVES
CRDQCRQLVDMIVTEDKEESEARTYLSELYNIELQMGHCEQRLVKRIQSPVGTDADAVHE
ITIYISEQERMQEELNRLKSELSVVSERCDDFVHKSPSGSCTPNLRSQLDLLVGKMDQIY
GLSSVFLEKLKTVDVVIRSLQEAEGMVKGFEIKLSQEASLNADTSFIQSQQDLLQQWLTE
AADKDSIISALENDIAKSKDVRERLYKMTQERSMDVEHYQERADKLRERWNAVHSQLETR
ESELLGIQESLRNYRGLHDNLIHWIEETKSQQEMMKPGQSEDRRVLSEQLSQQTALVAEI
EKNQTRLDKCQTISQQYSNLVKEYELQLMTYRACVESQQKSPMKRRRLFSSSDIITQEFM
DLRTRYTALVTLTTQHVKYISDALRRLEEEEKSFTHQPVKVYGKRIPIPRFHGLTATTLT
NGQRPLFSLFVTQALSEELLSQKEHISEAVKSMQIFLAKNSDRLSAQEKEELLSQIQELN
GKYSHLSEECDNQVQQLHTKLAQEAEQKVDHAVGGVIDLGSMEIFPIFWAIQRGLIDQDT
GLLLLEAQIVLSGLIVPATNERLNLKEALKHNIIDQRLFQFLKDLRDASKVVAGAGSKSG
KQKLLSVIAAMEDKKIRESDGLKILSIHFATGGFRLTAEEDVTNLERAAEAGLISRRLCQ
KLKSSSKSLVDPNTAKRMSLAEIMQTCIIHESTGLRLLPVKQLSVGMVCLKSGKKVSIFS
AVQEGLIDRQVAVRLLEAQLFAGGIKDTKTGHRLTVEEALRQQLMDQDMAIALLKRQLED
GGIIDTATGQIITLGEAVKQNIVSPKLALLVLESLGSFKGVLIPESGEILLVADALQLGI
ISTEFAINALGSRQRIQGLYMLEDRRILSWDDTVKCIIMDENIAKILQSIDIPDTISSLE
AGSASMPELGLCPGTLSVNSSPCPLESSELEMQRGACSEGNRELISHLMNVSYINIHSGK
RLLLTNKNENIVTKLFPGAFLDNSIVVSHNNKEEIHMQHTVEKKLESMALLANFTAKNTE
AVTNLEKNQCLLPREGRLPLDTHHAKLDETLSSLQNNHASQLQLAAHCGDVEEKMFKHPE
ISSFSTEQLLLPAVPENSANEINDSKTEISPVNKGLVDIQVQTLSVNGKLPEITAQSKTN
KAFEMSFDPDKVTNKSDLKTENVDVLNYIPEQQVASSKCLTVNAAYPEKIFCKGKLEDSG
GLLDNMHDHYDISSSEQVDNYAHVMEEEDALNMLSEQLTNGGIVVPNSSQKLLLNEAANH
GIISSHTALKLMERVGLFAGFFDSQTCERLTIQDVSQISQVPESDIRINDGVLMEQTQRN
ITXTDDFKVHCKPSAAETSVPSFFGEGLLDVNHFDTNMCVDETSLHVTSTKVYSDSQLSE
SKSTDGETSKLPCISLNLDKQELSPEVNCGPIFKNQEVKRLLPDTALFSPVPEKEHFTDR
LVNKHSEKITTITENVSKDLQKLQNDKQQGQIPISQCDLPMVSDQKPFTTSNYVPSENLP
FSQDLSQSDMSSVSRIFQKSGNIEFYSEVDMMYFDSQKYVKKYNDKIQQKLSEKELVIEH
EQQREGSCLTQDLYLCALNKSSVQSVINIQQECELIQTSGDLTVGKPNKNTVKQPKYLTD
AEPKVNTDNPAKENSEKVTVKPEKDLTAGTIKEGTRKPIKDIKSKQIKEDVVNPATNFKT
EIPTEHTVKPSNGVISKEDTVTSVRALTDVRFKQDAIKPTRQLALVKSKEGTFKPSRKPK
EDPVKVDQSLMEGNSKDETVNESNDRKEGPPKKKAEARPIEDTIEPGRDFALEKPKVSTT
DIDYSHQNIILSSIVILHKKLGFSRDKNAGITLNSFPLLKVKNLYLLYTDKCKSCGFSIE
HNHCVLQNQSSLDSYTISIKQTCLEHEENLVSYLSMLRDIEVRLGPVQPIPPSIKEVEEQ
LKQAEVKDSTLNFVWCYLSTQHFTLKHFNLRCKTMHSVNTKGTAVSFSLVQLLSGNTQAS
GGGGGVREFTHACSCGGFYDQRGWPRGARKDKCNGKLYCIIQKEKKKGIRIIMVDPVITI
RASRSSVVQVLDLELRQLMSPVSQELDFAKRIISDQPTEVPVQLLRALEKDAKNLEKSLT
SIKGNSELRVKQLQDALKTEKGKILVEHKELESKLHYLLQWVKETTDSLDSAKTNDDLRL
DAEKLQKELNHAESLRRPLTDTRQKLDNIAFDIQFFISEKAQDLTPQQSRTLLRLLNELQ
RSFRELSERLVAWEEVLQLYEKVLQNIGFLQILQEQQATCSKEFEELASWAEHTEKALPS
LQTFHKTTDLSSLMEQQKAVQVLHKDVQSRGKHFSRVIRAAEDFLAENKLKMDPVELESF
QKKLQQAKERYHAVLEKTGDTEKQLESAVSTAVLEETKKISTFLYLGKNKDNKKDEDIWI
LGSEINLETWIKQSETAEELKVNLGKIESLLSQVRPSYALLKTVPDGNETSFMVNELYER
KKTQHQEMLEQQQNFILTIQSAQDFLDKHGNTLCPEERQQLQNQLAQLKEEYSASMSQAQ
LQLKNAQVLRDEMQNFIRDHGEFEHWLIHTEEELDNMHKGKKDYNALKNLLNQQMNISED
IISHKGDLRYINLAGQKAIEAEKATADQCKEDFEMVAGAMVKNKLEEASKRYSTLQSKCS
KLGCHLNVVLDRYQQFQEGSDTAVAWLQVTELEVDCILSEPVASDPEVLQNQLAKAKGMQ
SNFAEHQVQVEKVHKALRMLLEIQDDPIPDCRSVQDIAADSIDRRFQNLSNQMSSHSDLL
QKTVAQSQSVQDALENLLQWLKEMEKTLAEQKHTRMSSASVEEALAVNMKLKQDISSRRG
SMDATGEMVGKFMETADSAAASALHSKLSEVTSRFNEVCMQQRLQENALKEILPKVEKYE
QFSNELQDFTVTRSHLLASGNQPERDITQFSEQIKELNAEIKQQEGHLLMVEQLARELSA
SPILTDASEHLQKLATLKKDFAELREAALARESETLSCQESLEQFQKLVGVMRKWLKEKE
DIVPSAEDSLKTCEMMSRLQQVKDLLSEWEMKSPKMAEIAQKGSELECCIMEITAPACQR
KGGSLLMATGSSLGNVNGYHTCQDLTGIQCDVSETSQKFENLGLLLHKREEQLSKMLENF
EKIKQETNHMLKWLESKEKTMTAVNVSPTKSEVVKAQAKQNKEFLSELEQSTEKVESLKA
ALRDLLEKHPNSPEAENWKTMLENLDQQWGRVNQVTAERQHKLEESANQLATFQVAGSQL
CPWLKEKELMMSVLGPLSVDPNMLNAQKQQVQFMLKEFEARKAQYEELKLAAYGILTGPG
EESPSTCQVEEEFHNISGKWMELTSRLNSRADQIDQATIKSSQYKEVLQRLTDKIKQAGK
NLAAQPAVSTQPDAVKQQLQETSGIRSELEQLAKEVTDAQKLCNELSALVMEPYLKDELQ
KRLDTVALPLKGMEDLAVDRVNRLQTALSSSQQFQQMFDELRSWLDEKQLQHVKSHPVSA
KLEKLQIQLQEQEEFQKSLSQYSGSYEMIVAEGESLLMSAQPGEEKTTLQNQLVNLKSNW
NELGKQSSERHGKLKDCLQKAQKYVRHVEDMVPWLEDCEIHMKEMEITLDPVQLEAQLLR
AKALQTDIDKKRSLLEMMNSAADLLIEAAEIDDRDILEERAKINQRIDAITEELHNKSGS
FEEMSLRLKELKDSFSNIDKKMEGAKHLLEIFTALGPQACSSKNLESMRSQQDMLLGLDS
QILYLKNLIQGLIADVPQDSDVSHLVYQAQQVQHDFEIVKEDVNECCANMETKLQGIGQF
HSHVREMFSELADLDDELDSMGPVGRDIDSLKSQAEVIQKFLEALLSLKSSIESSECKCR
DMLEKEGGPDLIVLMRELGTLNKQCSKLTERGKNRQGQLVATLRRVEEFNMKLKELNHQI
VTAEGSSVLQGVVGTEVDTIKQQLDNFKVFQKEQVDSLQAKLHQVNGIGQGLIQSADKNC
DVHGLEHDTEELNIKWNTLNKKVAERVTQLQEALLHCGKFQDALEPLLSWLTDTEDLIAN
QKPPSAEYKVVKAQIQEQKLLQRLLDDRRTTVEMIQAEGVRIAEGADPADGDKISHQLEI
LAERWSLLLQKAQSRQKQLEDILVLAKQFHETTEPIFDWLSATEKKLANSEPIGTQTGKI
QQQIQRHKALNEDIINRKKNVDQAIKNGQALLKQTTGEEVLLIQEKLDGIKTRYSEITAS
SGKALKTLEQALQLAGKFQATHDELTGWLRRAEDELSQSFGQSPSGDMIPQFQQQQKELK
KEAMEYRIVLDTINEVGSALLELVPWRAREGLDKLVADANEQYRSISDTIGQRVDQIDAA
IQRSQQYEQAADAELAWVAETKRKLLALGSICLEQDQTTAQLQVQKAFSVDIIRHKDSID
ELISTEEEILATCGDEQKSVLQEKTKNLVQHYEDISHLNSERYARLERAQVLVGQFWETY
EELIPWIDEMQVLFSQLPPPAVDHEMLRQQQEEMRQLRESVAEHKPHIDKLLKIGPHLSE
LNPEEGTAVQEKYRSAEKLYVGIKEEVRKRAMVLDDALAQAAQFHDKIGPMLETLESMAS
RLRMPPLIPAEVEKIRECISENKNAVMELEKLQPAFQALKHRGEELISRSQGPDIDPAAK
DIQDKLDQLVFFWEDIKARADERESKFLDVLELAEKFWLDMNTLLTTIKDTHEIVHDLES
PGIDPSMIKQQIEAADSIKEETDGLHEELEFIRILGADLIFACGETEKPEVKKSIDEMNT
AWENLKRTWAERIEKLRDAMSHAVQYQDSLQAMFDWLDNTVIKLCDMPPVGTDISTVKEQ
IEEMKEFKVEVYQQQIEMEKLNHQGELMLKKAIDDTDRDIIQGPLTELKHLWENLGEKIA
HRQQKLEDSLLALGQFQHALAELMSWLTHTNELLNAQRPICGDPKVIEVELAKHHVLKND
VLAHQSTVQIVNKAGNELLESSAGDDASSLRTRLETLNQLWEIVLQKTEEREQQLDMALQ
QAQGFSGEIEDFIQWQTNIESQLSAAKPTGGLPETAREQLQAHMELFAEIKANEDLYRHL
LDKGQLMLISRDDATGSITEQNVSILKRKWQAISNKVEERKAKLEEALTLATDFQNSLQD
FINWLTQAEQSLNIAPSPSLILDTVLFQIDEHKVFVNEVNIHREHIIELDKIGNQLKFLS
QKQDVVLIKNLLLSVQSRWEKVVQRSVERGRSLDDARKRAKQFHEAWKKLIDWLEEAENH
LDSELEISNDPDKIKLQLSKHKEFQKTLGSKQPVYDTTVRTGRALKEKALLSGDVQKLDH
LLGEVRDKWDTVCGKSVERQHKLEEALLFSGQFMDALQALVDWLYKVEPQLAEDQPLHGD
LDLVMNLMDAHKVFQKELGKRTSSVQALKRSARELLESSREDTTWVKVQLQELSTRWDTV
CKLSVSKQTRLEQALKQAEEFHAAVHMLLEWLSEAEQTLRFRGALPDDAESLQSLIDIHK
EFMRKVEEKQIDVNTAVSMGEEILTMCHPDCITTIKHWITIIRARFEEVLTWGNQHQQRL
QTALSELLANSELLDELLSWIQWAETTLIQRDQDPMPQNIDQVKALISEHQVFMEEMTQK
QPDVDRVTKTYKRKTTDTNHASFNDKTRRKHSVQNATPVLPVLSQPETKNPRINQLSARW
QQVWLLALERQRKLNDALDRLEELKEFANFDFDIWRKKYMRWMNHKKSRVMDFFRRIDKD
QDGKITRQEFIDGILASKFPTTRLEMTAVADIFDRDGDGYIDYYEFVAALHPNKDAYRPT
TDADKIEDEVTRQVAQCKCAKRFQVEQIGENKYRFFLGNQFGDSQQLRLVRILRSTVMVR
VGGGWMALDEFLVKNDPCRVHHPGNKLKRTDSISSIASRLPTISTSLKTSRSSLTGDTPT
SSSAKSGRAGKRPIAARDLDRQKGAGPPFRTSAFSHTSVSAYCFAPSGAHSAQGQNAHGE
KRFSQGPCHSQAEPPGRQELVIAAVAAWDREVFEGINSDPKKSASRAGSRAGSRASSRRG
SDASDFDLLETQSACSDTSESSAAGGPGSSRRGLSKPSKIPTMSKKTASTPKTQGTKR
Download sequence
Identical sequences F6XSC1
ENSXETP00000016058 ENSXETP00000016062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]