SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000017177 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000017177
Domain Number 1 Region: 138-385
Classification Level Classification E-value
Superfamily vWA-like 1.22e-75
Family Integrin A (or I) domain 0.00000000948
Further Details:      
 
Domain Number 2 Region: 381-470
Classification Level Classification E-value
Superfamily Integrin domains 6.28e-30
Family Integrin domains 0.0000131
Further Details:      
 
Domain Number 3 Region: 637-721
Classification Level Classification E-value
Superfamily Integrin beta tail domain 2.75e-23
Family Integrin beta tail domain 0.0000125
Further Details:      
 
Domain Number 4 Region: 33-87
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000000157
Family Plexin repeat 0.00018
Further Details:      
 
Domain Number 5 Region: 595-636
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000017
Family Integrin beta EGF-like domains 0.00083
Further Details:      
 
Domain Number 6 Region: 553-591
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000022
Family Integrin beta EGF-like domains 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000017177
Domain Number - Region: 478-505
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0335
Family Integrin beta EGF-like domains 0.023
Further Details:      
 
Domain Number - Region: 522-553
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0419
Family Integrin beta EGF-like domains 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000017177   Gene: ENSXETG00000019163   Transcript: ENSXETT00000017177
Sequence length 793
Comment pep:known scaffold:JGI_4.2:GL173609.1:169887:187173:-1 gene:ENSXETG00000019163 transcript:ENSXETT00000017177 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QKHRGRIHPVYNVISPVGLVHKFGCTVFISGASICATRGVTSCQKCLAVNPQCAWCSQEN
FGKGAPRCDLKSALLSNGCEMENIEFPVSTFQVAENRPLSVKGSEGDTREITQISPQKID
LYLRPDDPKVFNLQVRQVEDYPVDIYYLMDLSYSMKDDLIKIQTLGTSLSERMRRLTSNL
RIGFGAFVDKPMAPYMFMSPPEVIKNPCYEFHTECMPTFGYKHILALTDEVTRFNEEVQK
QKVSRNRDSPEGGFDAVIQAAVCDNKIGWRNESSHLLVFTTDARTHIALDGRLAGIVQPN
DGKCHLDLNNNYAASTTLDYPSIGLMTEKLSEKNINLVFAVTNEVLSLYTSYTKYYTEQD
CPTPTTKQASIFQITFPAYQKIRSKVELEVRDLPEELSLSFSASCQNDEFTPGLKSCTGL
KIGDTVSFSIEAKVRECPSVREKTFTIKPVGFKDSLTVTVHFQCDCACQDYDQPNSTLCN
HGNGTLSCGICQCNPGWLGPYCECSEEDYNPSQQDRCSPKEGATICNRRGECVCGQCVCH
ANDLGKVWGKYCECDDFSCLRYKGEMCSGHGQCNCGDCICESDWTGHYCNCTTRTDTCMS
SSGLLCSGRGQCVCGKCECTQPGSYGDTCEKCPTCPDACTFKKGCVECKKFERGPWFEDS
SCKHICRDEIESVNELVDNGKNAVNCTYKDENDCVVRFQYYEDSSGKSVLYVINEAECPQ
GPDILVVLMSVMGAILLIGLVALLIWKLLISIHDRREFVKFEEERAKAKWDTAHNPLYKG
ATSTFTNITYRGN
Download sequence
Identical sequences F6SRR1
ENSXETP00000017177 ENSXETP00000017177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]