SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000017222 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000017222
Domain Number 1 Region: 2-257
Classification Level Classification E-value
Superfamily Sema domain 3.92e-103
Family Sema domain 0.0000000222
Further Details:      
 
Domain Number 2 Region: 253-304
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000117
Family Plexin repeat 0.0021
Further Details:      
 
Domain Number 3 Region: 320-401
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000037
Family I set domains 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000017222   Gene: ENSXETG00000007874   Transcript: ENSXETT00000017222
Sequence length 490
Comment pep:known scaffold:JGI_4.2:GL172681.1:558815:641680:1 gene:ENSXETG00000007874 transcript:ENSXETT00000017222 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIARVCPNDIGGQRSLVNKWTTFLKARLVCSVMDDDGTETYFDELEDVFLMETDNPRTTL
VYGIFTTSSSVFKGSAVCVYHMSDIQTVFNGPFAHKEGPNHQLIPYQGRIPYPRPGTCPG
GAFTPNMKSTKEFPDDVVTFIRNHPLMFNSIYPTLKRPLLIRTGTDYKFTKIVVDRVNAA
DGKYHVLFLGTDKGTVQKVVVVPANGSASGELILEEMEVFKSHAPITSMKISSKKQQLYV
SSEEGITQLSLHRCHIYGTACADCCLARDPYCAWDGKFCSRFYPSGKRRSRRQDVKHGNP
VTQCRGFNLKGYRNTAEIVQYGVRNNTTFLECIAKSPQASVKWLLQKDNDRRKEVKLNER
IIATGQGLLIRSVQEVDQGLYHCIATENTFKQTIAKVNLKVLEPELVTFMTDKSQWLWAS
TLSGMQFHPKDLTGAFSHSEMQIINQYCKESRQKTRQEAENQKMRGDYSKLKVLLNTRKS
RNRRNHFPGS
Download sequence
Identical sequences F7AQT4
ENSXETP00000017222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]