SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000017224 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000017224
Domain Number 1 Region: 31-520
Classification Level Classification E-value
Superfamily Sema domain 4.32e-177
Family Sema domain 0.0000000000828
Further Details:      
 
Domain Number 2 Region: 516-567
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000209
Family Plexin repeat 0.0021
Further Details:      
 
Domain Number 3 Region: 583-664
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000659
Family I set domains 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000017224   Gene: ENSXETG00000007874   Transcript: ENSXETT00000017224
Sequence length 753
Comment pep:known scaffold:JGI_4.2:GL172681.1:599077:641680:1 gene:ENSXETG00000007874 transcript:ENSXETT00000017224 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EQFNCICALFVVFVPCCICKSIFSIIKQITIFVVFFTELQETKTSEFYSISQSPLDYRIL
LMDEDQDRIYVGSKDHILSLNINNISHDPLSVFWPASTSKVEECKMAGKDPTHGCGNFVR
VIQNFNRTHLYVCGSGAFSPVCTYINRGRRSEDHIFAIDYKNESGKGRCSFNPKVNTVSV
MINEELFSGMYIDFMGTDSAIFRSLTKRNAVRTDQHNSKWLSEPIFVDAQLLPDGTDPND
AKVYFFLKERLTDNSGSTKQIHSMIARVCPNDIGGQRSLVNKWTTFLKARLVCSVMDDDG
TETYFDELEDVFLMETDNPRTTLVYGIFTTSSSVFKGSAVCVYHMSDIQTVFNGPFAHKE
GPNHQLIPYQGRIPYPRPGTCPGGAFTPNMKSTKEFPDDVVTFIRNHPLMFNSIYPTLKR
PLLIRTGTDYKFTKIVVDRVNAADGKYHVLFLGTDKGTVQKVVVVPANGSASGELILEEM
EVFKSHAPITSMKISSKKQQLYVSSEEGITQLSLHRCHIYGTACADCCLARDPYCAWDGK
FCSRFYPSGKRRSRRQDVKHGNPVTQCRGFNLKGYRNTAEIVQYGVRNNTTFLECIAKSP
QASVKWLLQKDNDRRKEVKLNERIIATGQGLLIRSVQEVDQGLYHCIATENTFKQTIAKV
NLKVLEPELVTFMTDKSQWLWASTLSGMQFHPKDLTGAFSHSEMQIINQYCKESRQKTRQ
EAENQKMRGDYSKLKVLLNTRKSRNRRNHFPGS
Download sequence
Identical sequences F7A4E3
ENSXETP00000017224 ENSXETP00000017222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]