SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000018010 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000018010
Domain Number 1 Region: 240-440
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.19e-49
Family DBL homology domain (DH-domain) 0.00000000963
Further Details:      
 
Domain Number 2 Region: 2-120
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.45e-26
Family Calponin-homology domain, CH-domain 0.0006
Further Details:      
 
Domain Number 3 Region: 432-544
Classification Level Classification E-value
Superfamily PH domain-like 7.54e-26
Family Pleckstrin-homology domain (PH domain) 0.0000373
Further Details:      
 
Domain Number 4 Region: 166-235
Classification Level Classification E-value
Superfamily SH3-domain 4.46e-24
Family SH3-domain 0.0000607
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000018010
Domain Number - Region: 798-854
Classification Level Classification E-value
Superfamily Oxygen-evolving enhancer protein 3, 0.00955
Family Oxygen-evolving enhancer protein 3, 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000018010   Gene: ENSXETG00000008213   Transcript: ENSXETT00000018010
Sequence length 862
Comment pep:known scaffold:JGI_4.2:GL172678.1:1001448:1090076:-1 gene:ENSXETG00000008213 transcript:ENSXETT00000018010 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSAEQTVTWLITLGVLESPKKTISDPEGFLQTSLKDGVVLCRLLERLLPGSIDKVYPEP
RTDTECLGNIREFLRGCSAFNLETFDANDLYQGQNFNKVLNSLVLLNKVTADIGLGSDSV
CARSSSHRIKSFDSLGSQSVLSRSSKLLQSQYRSLDMTENSNHHMVVRAKFNFQQTNEDE
LSFNKGDLIHVTRLEEGGWWEGTHSGKTGWFPSNYVREVKSSEKPVSPKSTTLKSPPKGF
DTSAINKSYYNVVLQNILDTEGEYSKELQDILSNYLRHLQTSEKLSPTNISYLLGNLEEI
CAFQQILVQSLEECTKLPEGQQRVGGCFMSLMPQMKSLYIAYCANHPSAVNVLTQHSEEL
GEFMEMKGANSPGILVLTTGLSKPFMRLDKYPTLLKELERHMEDYHPDRPDIQKSMTAFK
NLSAQCQEVRKRKELELQILTETIRGWEGEDIKTLGTVIYMSQVMIQCAGSEEKNERYLL
LFPNVLLMLSASPRMSGFIYQGKIPLTGMCVTKLEDNENHKNAYEIAGKSVITRILISCA
SDIDYGKAVYDYPKHVKPECPEPLLLTPYELPTSTLPSHPVTPSSKHSDCKLMPLTPAYH
TLPHLSHHGTPHSTISWSPLEPPKTPKPWSLSCLRPAPPLRPSAALCYKEDLSKSPKTMK
KLLPKRKPERKPSDEEFALRKSTAALEEDAQILKVIEAYCTSAKTRQTLNSTWQGTDLMH
NHVLADDDQSSLDSLGRRSSLSRLEPSDLSEDSDYDSIWTAHSYRMGSTSRCRKGSTPQV
LLPEEEKIIVEETRSNGQTVIEEKSLVDTVYALKDEVQELKQDSKKMKKSLEEEQRARKE
LEKLIRKVLKNMNDPSWDETNL
Download sequence
Identical sequences F7CU97
ENSXETP00000018009 ENSXETP00000018010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]