SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000018967 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000018967
Domain Number 1 Region: 2-243
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.6e-78
Family Calponin-homology domain, CH-domain 0.00011
Further Details:      
 
Domain Number 2 Region: 1402-1519
Classification Level Classification E-value
Superfamily E set domains 5.54e-36
Family Filamin repeat (rod domain) 0.0000136
Further Details:      
 
Domain Number 3 Region: 1309-1423
Classification Level Classification E-value
Superfamily E set domains 1e-31
Family Filamin repeat (rod domain) 0.0000126
Further Details:      
 
Domain Number 4 Region: 1041-1130
Classification Level Classification E-value
Superfamily E set domains 5e-31
Family Filamin repeat (rod domain) 0.00000489
Further Details:      
 
Domain Number 5 Region: 1499-1612
Classification Level Classification E-value
Superfamily E set domains 1.93e-30
Family Filamin repeat (rod domain) 0.0000335
Further Details:      
 
Domain Number 6 Region: 1219-1329
Classification Level Classification E-value
Superfamily E set domains 3.8e-30
Family Filamin repeat (rod domain) 0.00000659
Further Details:      
 
Domain Number 7 Region: 1133-1242
Classification Level Classification E-value
Superfamily E set domains 3.8e-29
Family Filamin repeat (rod domain) 0.0000101
Further Details:      
 
Domain Number 8 Region: 723-846
Classification Level Classification E-value
Superfamily E set domains 7.34e-29
Family Filamin repeat (rod domain) 0.00072
Further Details:      
 
Domain Number 9 Region: 826-946
Classification Level Classification E-value
Superfamily E set domains 1.4e-28
Family Filamin repeat (rod domain) 0.00047
Further Details:      
 
Domain Number 10 Region: 2007-2100
Classification Level Classification E-value
Superfamily E set domains 1.85e-28
Family Filamin repeat (rod domain) 0.0000101
Further Details:      
 
Domain Number 11 Region: 1606-1712
Classification Level Classification E-value
Superfamily E set domains 3.14e-27
Family Filamin repeat (rod domain) 0.0000119
Further Details:      
 
Domain Number 12 Region: 2197-2290
Classification Level Classification E-value
Superfamily E set domains 3e-26
Family Filamin repeat (rod domain) 0.00000947
Further Details:      
 
Domain Number 13 Region: 644-744
Classification Level Classification E-value
Superfamily E set domains 4.14e-26
Family Filamin repeat (rod domain) 0.00044
Further Details:      
 
Domain Number 14 Region: 1820-1919
Classification Level Classification E-value
Superfamily E set domains 1.13e-25
Family Filamin repeat (rod domain) 0.000024
Further Details:      
 
Domain Number 15 Region: 433-546
Classification Level Classification E-value
Superfamily E set domains 3.8e-25
Family Filamin repeat (rod domain) 0.00066
Further Details:      
 
Domain Number 16 Region: 2389-2480
Classification Level Classification E-value
Superfamily E set domains 1.47e-24
Family Filamin repeat (rod domain) 0.0000168
Further Details:      
 
Domain Number 17 Region: 2296-2386
Classification Level Classification E-value
Superfamily E set domains 6.34e-24
Family Filamin repeat (rod domain) 0.0000133
Further Details:      
 
Domain Number 18 Region: 2517-2608
Classification Level Classification E-value
Superfamily E set domains 1.67e-23
Family Filamin repeat (rod domain) 0.0000232
Further Details:      
 
Domain Number 19 Region: 551-642
Classification Level Classification E-value
Superfamily E set domains 1.87e-23
Family Filamin repeat (rod domain) 0.00016
Further Details:      
 
Domain Number 20 Region: 1906-2003
Classification Level Classification E-value
Superfamily E set domains 5.34e-22
Family Filamin repeat (rod domain) 0.00000597
Further Details:      
 
Domain Number 21 Region: 954-1055
Classification Level Classification E-value
Superfamily E set domains 6.67e-21
Family Filamin repeat (rod domain) 0.00082
Further Details:      
 
Domain Number 22 Region: 2118-2212
Classification Level Classification E-value
Superfamily E set domains 7.34e-21
Family Filamin repeat (rod domain) 0.0000615
Further Details:      
 
Domain Number 23 Region: 349-454
Classification Level Classification E-value
Superfamily E set domains 1.47e-20
Family Filamin repeat (rod domain) 0.00093
Further Details:      
 
Domain Number 24 Region: 1760-1835
Classification Level Classification E-value
Superfamily E set domains 5.6e-17
Family Filamin repeat (rod domain) 0.00031
Further Details:      
 
Domain Number 25 Region: 277-366
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000474
Family Filamin repeat (rod domain) 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000018967   Gene: ENSXETG00000008663   Transcript: ENSXETT00000018967
Sequence length 2609
Comment pep:known scaffold:JGI_4.2:GL172762.1:2068583:2219752:1 gene:ENSXETG00000008663 transcript:ENSXETT00000018967 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVTEKDLAQDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQK
RMYRKYHQRPTFSQMQLENVSVALEFLERENIKLVSIDSKAIVDGNLKLILGLIWTLILH
YSISMPVWEDEGDEETKNQTPKQRLLGWIQNKIPQLPITNFSQNWQDGKALGALVDSCAP
GLCPDWESWDPKKPVENAREAMQQADDWLGVPQVIAPEEIIDPNVDEHSVMTYLSQFPKA
KLKPGAPLKPKLNPKKARAYGPGVPCSVNLVCTRVRLGIVTISVQGDIMQVSLGGSRLNK
GKAKVTGNNDKNKTFSVEYVPKVTGMHKVTVLFAGQHIAKSPFEVNVEKAQGDASKVTAK
GPGLEPIGNIANKPTYFDIYTAATGAGVGDIGIEVIDPQGRNNTVELALEDKGNCVYRCT
YKPIKAGPHNVAINFGGEATPKSPYLVSIGEACNPNACRANGRGLQPKGVRIRETADFRV
DTKAAGSGDLHVSVKGPKGLDEVLKQSESLDGLHLFEYYPLTPGKYVVAITWGGHHIPKS
PFEVQVALEAGPQKVRAWGPGLYSGMAGKAADFVVESVGSEVGSLGFAIEGPSQAKIECE
DQGDGSCDVRYWPKEPGEYAIHIMCDDEDIQNSPYMALIQPASGDIDPDKVKAYGPGLEK
TGCIVSTPAEFAVDPTDAGKAALKIYSQDVEGNPVDIMTKEKPDGTYACSYTPAKPIKHT
VAVTWGGVSVPNSPFRVNIGQGSHPHLVKVFGPGVEKTGLKANEPTHFTVDCTEAGEGDV
SVGIKCDARVISDEEEDIDFDIIPNANDTFTVKYMPPAAGRYTIKVLFAGEEIPESPFRI
KVDPSHDASKVRAEGPGLSKSGVENGKPSHFTVYTKGAGKAPVDVSFTGPAPGDAVKDFE
IIDNYDYSHTVRYTPVQQGKMKVAVNYGGDPIPKSPFTVGVAAPLDLNKIRINGLESRVE
VGKDQQFIVDPNGAGGQGKLEVKISSPSRKSVPCLVEPVPGNECSTVKYIPKEEGLYNVD
VSYDGNPVPGSPYVVEATLPPDPSKVKAYGPGLEGGLVGKPAEFTIDTKGAGTGGLGLTV
EGPCEAKIECSDNGDGTCSVSYLPTTPGEYFVNILFEETHIPGSPFQANVEMPFDPSKVI
ATGPGLEHGKVGEAGLIHVDCSQAGPGNLAVEAVSDSGSKAEVNVQDNKDGTYTVTYVPL
FAGMYTLALKYGGEQVPKFPARVKVDPAVDTSKIKVFGPGIEEKGVFREATTDFTVDAKS
LTKTGGNHVKTKITNPSGASTDYLLRDNGDGTYYVEYTPFEKGAHAIKVTYDDEPVPNSP
FKVGVTEGCYPDRVKAQGAGLTEALTNKPNLFSVITSRGAGIGGLGITVEGPSESKMSCK
DNKDGSCSVEYTPYVTGDYDVNITYDGEHIPGSPFRVPVKDVVDPSKVKISGPGLGTAVR
AKIPQQFTVDTSKAGIAPLAVQVTGPRGTVEPVDLVDNGDGTHTVSYTPTLEGPYTVAVQ
YADEEIPRSPFKVKVLPTYDASKVTASGPGLCAQGISASLPVNFAVDAKNAGLGPLSVQI
TDQEGKPKKAQIQDNNDGTYSVSYIPDRTGRYHVAVKYGGDDIPYSPYRIRAMSIGDASK
CTVAGPGIQAAVKTGEEVGFVVDATTAGKGKVTCSILGPDGLENEADVIENVDGTYDIYY
TTAKTGPYVIHVRFGGADIPNSPFTVMATDEVPVQVQQQSLSACPPGYQPLVSETDYAQV
GSMNGLSFRPFDLVIPFAIRTGEITGDVHMPSGKTAPADIVDNKDGTVSIRYVPTETGLH
ELAIKCNGAHIPESPLQFFVNYPNTGSVSAYGPGLIYGVANKPATFTIITEDAGEAQSGG
LDLAIEGPSKAEISCIDNKDGTCTVTYLPTLPGDYNILVKYNDTHIAGSPFIAKITDDSR
RRSQVKLGSTADFLLDITETDLSLLSASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGE
HLVSIKKNGRHIPNSPISIMVYQSEIGDASKVKAFGPGLIEGRTYEMSDFIVDTREAGYG
GLSLAVEGPSKVDIQTEDLEDGTCQVSYCPTEPGVYIVSIKFADEHVPGSPFTAKVMGEG
RVKESITRRRKAPSVASVGGLCELNLKIPEIDRNELTAEVVSPSGRKQEAEIVDLGQNTS
CVRFVPQETGIHTVSVKYRGEHVPGSPFQFTVGPLGEGGAEKVKAGGPGLERGEAGVPAE
FSIWTREAGAGGLSIAVEGPSKAEISFEDRKDGSSGVSYVVQEPGDYDVIIKFNDEHIPQ
SPFLVPIVATSDDARRLTVTSLQESGLKVNQPASFAIRLNGARGKIDAKVHSPSGAVEEC
FVTELEPDKYAVRFMPRENGIHMIDVKFNGSHVPGSPFKVRVGEAGQEGDPGLVTAYGDG
LETGTTGKQSEFIINTSKAGPGALSVTIEGPSKVTMECKECPEGYRVLYTPMAPGIYMIG
VKYGGPNHIVGSPFKAKVTGQRLVGIGGTSETSSIIVQSVTRASTETTYSALPRFASDAT
KVTSKGAGLSKAFLGQKSTFTVDCSKAGSNILLVGVHGPTLPCEEVSIKHLGNKHYTVHY
HVKERGDYMLVVKWGEEHIPGSPFHITVP
Download sequence
Identical sequences F6RGN3
ENSXETP00000018967 ENSXETP00000018967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]