SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000019554 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000019554
Domain Number 1 Region: 22-281
Classification Level Classification E-value
Superfamily YWTD domain 5.75e-56
Family YWTD domain 0.00000168
Further Details:      
 
Domain Number 2 Region: 633-888
Classification Level Classification E-value
Superfamily YWTD domain 5.1e-54
Family YWTD domain 0.00000377
Further Details:      
 
Domain Number 3 Region: 332-570
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-51
Family YWTD domain 0.00000234
Further Details:      
 
Domain Number 4 Region: 936-1193
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-38
Family YWTD domain 0.0000452
Further Details:      
 
Domain Number 5 Region: 890-939
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000367
Family EGF-type module 0.013
Further Details:      
 
Domain Number 6 Region: 1326-1364
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000102
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 1248-1286
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000497
Family LDL receptor-like module 0.00088
Further Details:      
 
Domain Number 8 Region: 1288-1323
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000072
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 9 Region: 589-635
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000156
Family EGF-type module 0.008
Further Details:      
 
Domain Number 10 Region: 284-325
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000212
Family EGF-type module 0.0076
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000019554
Domain Number - Region: 1204-1258
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00011
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000019554   Gene: ENSXETG00000008917   Transcript: ENSXETT00000019554
Sequence length 1613
Comment pep:known scaffold:JGI_4.2:GL173697.1:13804:64013:1 gene:ENSXETG00000008917 transcript:ENSXETT00000019554 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAEYFLFVITCISCALSVASPLLLYANRRDLRLVDAAGMKGNSTVVVSGLEDAAAVDFV
FFRGLIYWSDVSEEAIKRIDFNKTGSSHDVVISGLLSPDGLACDWLGEKLYWTDSETNRI
EVSNLDGSLRKVLFWQELDQPRAIALDPTRGYMYWTDWGDVPKIERAGMDGSLRSVIIDS
DIYWPNGLTLDYDEQKLYWADAKLSFIHKANLDGSHRQTVIKGSLAHPFALTLFGDTIYW
TDWTTRSILACNKYTGEDRREVDSDIFSPMDIHVFSRLRQPNATNPCAVHNGGCSHLCLM
SPMEPFYQCACPTGVRLMEDGKMCMHGATELLLLVRRTDLRRISLDTPDFTDIVLPLDDI
RHAIAIDYDPVEGYIYWTDDEVRAIRRTQIDGSSSQYIVTSQVAHPDGIAVDWVARNLYW
TDTGTDRIEVTRLNGTMRKILISEDLDEPRAIVLDPMNGYMYWTDWGEIPKIERAAMDGS
DRIILVNTSLGWPNGLALDYAEGKIYWGDAKTDKIEVMTTDGTGRRVLVEDKLPHIFGFT
LLGDYVYWTDWQRRSIERVHKRTGEREVIIDQLPDLMGLKATNIHKMSGTNGCAENNGGC
SHLCLFRPQGPRCACPIGLELISDMKTCIVPEAFLLFSRRADIRRISLETSNSHVAIPLT
GVKEASALDFDVTDNRIYWTDVSLKTISRAFMNGSALEHVVQFGLDYPEGMAVDWLGKNL
YWADTGTNRIEVSKLDGQHRQILVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRTAMD
GSGRITLVPDVGRANGLTIDYAERRLYWTDLDTNLIESSNMLGLDRVVIADDLPHPFGLT
QYQDYIYWTDWSQRSIERANKTSGQNRTMIQNDLDYVMDILVFHSSRQAGWNECASSNGH
CSHLCLATPVSGYTCGCPVHHSLNADNKTCSPPSSFLLFSQKNAINRMVIDEQQSPDIIL
PIHNLRNVRAIDYDPLEKQLYWIDSRQNIRRAQEDGSQSMTVVASTVPNQNIDMQPYDLS
IDVYSRLIYWTCEATNVINVTRLDGRAIGVVLKGEQDRPRAILVNPERGYMYFTNLQERS
PKIERAALDGTEREVLFFTGLSKPVALALDNKMGKLFWADSDLRRIESSDLSGGHRIVLE
DSNVLQPVGLTVFGNHLYWIDRQQQMIERIEKTGRVGRTKIQARIPLLTDIHAVTELSMD
EYKEHPCSQDNGGCSHICIVKGDGTTRCSCPMHLVLLQEDELSCGEPPTCSPLQFTCFTG
EVDCIPAEWRCDGFTECEDHSDEQNCPMCSDTQYQCASGQCIDSSLRCNGEANCQDKSDE
KNCNEVCAPDQFHCGSGQCIGKHRRCDLSPDCSDSSDEQACYPTEEPPPPSTNTIGSIIG
VILTVFVVGGVYFICQRVLCRRMKGDGETMANDYVVHGPASVPLAYVPHPSSLTGSLPGM
SRGKSVISSLSIMAGSSGPPYDRAHVTGASSSSSSSTKGTYFPPILNPPPSPATERSHYT
MEFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYTPSHRITSAAAKGYTSDL
NYDSEPVPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences F6YLU8
ENSXETP00000019554 ENSXETP00000019554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]