SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000019814 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000019814
Domain Number 1 Region: 1-76
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 1.57e-25
Family Cytochrome b5 0.002
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000019814
Domain Number - Region: 321-375
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0645
Family Calponin-homology domain, CH-domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000019814   Gene: ENSXETG00000009043   Transcript: ENSXETT00000019814
Sequence length 420
Comment pep:known scaffold:JGI_4.2:GL173805.1:43800:67900:-1 gene:ENSXETG00000009043 transcript:ENSXETT00000019814 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EEIQKHNLKTDKWLVIERKVYNITQWVKCHPGGMRVIGHYAGEDATDAFHAFHPDKNFVR
KFLKPLYVGELAENEPSQDRDKNAQQVEDFRALRKTAEDMGLFKSNPAFFIVYLFHILLI
EFLAWCTLHYFGTGWIPTILTVLLLTISQAQAGWLQHDFGHLSVFKKSKWNHLIHKFIIG
HLKGASANWWNHRHFQHHAKPNIFRKDPDVNMVNVFVLGDTQPVEEPSANIALLVNNHNA
FLFPVGPPLLIPIYFTIQIMKTMITRKDWVDLAWSVSYYARFFITFVPFYGVLGSLALLN
AVRFIESHWFVWVTQMNHLPMVIDHEKYKDWLETQLAATCNIEPSFFNDWFSGHLNFQIE
HHLFPTMPRHNYWKIAPLVRSLCSKYNVTYEEKCLYHGFRDVFRSLKKSGQLWLDAYLHK
Download sequence
Identical sequences F6W9I4
ENSXETP00000019814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]