SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000019849 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSXETP00000019849
Domain Number - Region: 171-244
Classification Level Classification E-value
Superfamily Kelch motif 0.00183
Family Kelch motif 0.018
Further Details:      
 
Domain Number - Region: 209-308,362-394
Classification Level Classification E-value
Superfamily YWTD domain 0.0392
Family YWTD domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000019849   Gene: ENSXETG00000009057   Transcript: ENSXETT00000019849
Sequence length 399
Comment pep:known scaffold:JGI_4.2:GL172971.1:362213:367156:-1 gene:ENSXETG00000009057 transcript:ENSXETT00000019849 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELMFIRILVLFVLYTDTNSQGEAQDSIMVRYIESRVVSLEDRLYKCEQVLHHYDYELKG
LSYRLISRLEELSRYRADVKSEMENLLGRIERAEWDIDYLETASPSNTCVEMDERLVKTQ
LENAEEEKRKIMQKLNTSCATMLAKIKSQKMVKRSGGAVGSWMRNAGNSSEGIYFFSGTN
GDTFLEFTNMEDFTNIDSMEKAKNVSLPYPWQGTGQAVHNNFMFFHRNGTLNEIVKYDLR
GENVTGILELAGAGSIPPYQLSPFTFIDLGFDEHGLWSMHGDAGNGGNIVLTKIDYRTMV
MEQSWNTSCQSANAEAAFVLCGTLYVVYNTASGGRSHIDCIYDTSGIITENKMSTLYFLR
RYSSHASIKHNPIEKALYAWDEGYQTVYKFDTRAKYEHP
Download sequence
Identical sequences F6UPT0
ENSXETP00000019849 XP_002938082.3.99540 ENSXETP00000019849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]