SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000020964 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000020964
Domain Number 1 Region: 60-275
Classification Level Classification E-value
Superfamily EF-hand 3.66e-51
Family Penta-EF-hand proteins 0.00000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000020964   Gene: ENSXETG00000009501   Transcript: ENSXETT00000020964
Sequence length 278
Comment pep:known scaffold:JGI_4.2:GL173735.1:106624:107688:1 gene:ENSXETG00000009501 transcript:ENSXETT00000020964 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLMKQLNQGGIGNVLQGLTGGQGGGGGGGQGGVGNILQGAISGIAGGQGGGGGQAGGGG
GQGGVGGMNILGGIINVIGEVIANYKPAPPPVPVANAYQQEANENDEQRQFRRLFKQLAG
DDMEVNSEELKNVLDKVVAKHQDLKTDGFSVDTCRSMVAIMDSDGTGKLGFEEFKYLWNN
IKKWQCIYKQFDTERSGYINCQALPGALKAAGFDLHEQLHVLLARRYADENGNINFDSFI
SALVRLDAMYRAFKALDRDNDGQVEVRMPEWLKLTIYS
Download sequence
Identical sequences F7DGI8
ENSXETP00000020964 ENSXETP00000020964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]