SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000022319 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000022319
Domain Number 1 Region: 347-590
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.28e-78
Family Eukaryotic proteases 0.00019
Further Details:      
 
Domain Number 2 Region: 252-353
Classification Level Classification E-value
Superfamily SRCR-like 0.00000000000000314
Family Scavenger receptor cysteine-rich (SRCR) domain 0.022
Further Details:      
 
Domain Number 3 Region: 204-242
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000628
Family LDL receptor-like module 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000022319   Gene: ENSXETG00000010124   Transcript: ENSXETT00000022319
Sequence length 592
Comment pep:known scaffold:JGI_4.2:GL172675.1:623054:655454:-1 gene:ENSXETG00000010124 transcript:ENSXETT00000022319 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TGTTSSTVNPTVPTASSSNIPRSMGTTANATNPTVPTASSSNIPRSTGTTANATNPTVPT
ASSSNIPRSTGTTANATNPTVPTASSSNIPRSSGTTANATNPTVPTRTPAASTHTPNPTR
TPVPTTHTPGPVRTPANAPRVPGPSRTPGPVRGTPRPVPKPPTSGPTVTYKKEKAFPIRK
YCVPTVAVLLVLASIAVIAILIKVVLDNYYFFCVKSFKFIPLDQWCDGKSDCTGGEDESR
CVQPFDVTTNSNVRFAEAGSVLQLYVQARSSWSFICNDNWDTNKAKAVCAQVGFYSEPVS
GTVSISDLSTSSALLYSTVQVLSDKSIQVNPTVWGSCTSGQVVSLRCAACGTGHKQERII
GGSNSDILKYPWQVSLQYMGQHICGGSILNSRWILCAAHCFDRGQRQVDRWRVQYGITTL
TYLFGTFVDKIFLNSKYVTDQKPNDIALLQLKSDIVASASVQPVCLPGYDNNLVVGAVLY
VTGWGHTVEGGAALASQLQEVAISLISSTTCNQEYGGQILDTMLCAGKIAGGADTCQGDS
GGPLVSLGQSSHWEQVGIVSWGDGCGRPNRVGVYTDVQSFLNWIYGVMKQNP
Download sequence
Identical sequences F6VB20
ENSXETP00000022319 8364.ENSXETP00000022319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]