SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000022322 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000022322
Domain Number 1 Region: 120-366
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.96e-83
Family Eukaryotic proteases 0.0000958
Further Details:      
 
Domain Number 2 Region: 23-127
Classification Level Classification E-value
Superfamily SRCR-like 0.0000000157
Family Hepsin, N-terminal domain 0.029
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000022322
Domain Number - Region: 1-25
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000511
Family LDL receptor-like module 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000022322   Gene: ENSXETG00000010125   Transcript: ENSXETT00000022322
Sequence length 369
Comment pep:known scaffold:JGI_4.2:GL172675.1:761603:771698:1 gene:ENSXETG00000010125 transcript:ENSXETT00000022322 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CLSNVTLCNGVAECERGGDEMGCARFLWDNSMVEVMSRKKENLWLPVCYNEYSSDFPSFV
CQRYGFEGPCSQFYSVLSAPLSLGQFSFNRILSSDSSVQICKKVCHITTCANGQYLSLRC
LDCGKRMANRIIGGVSAKLGDYPWQVSLHQRAGNRFAHVCGGTIINNKWVATATHCFQET
VDPANWRVYAGIINQHNLNAMHTVTVIVRNENYNSDTDDFDMALMKMKQPFIFTAAIQPA
CLPMMNQNFGQNDICFISGFGKTIQSSDEGSQYLMQAQVHVIPTSVCNKVNVYNGAITPR
MMCAGYLQGQIDSCQGDSGGPLVCQQGGIWYLAGVTSWGSGCGQANKPGVYSNVNAFLQW
IYKQIEVRS
Download sequence
Identical sequences F6VAW7
ENSXETP00000022322 ENSXETP00000022322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]