SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000022469 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000022469
Domain Number 1 Region: 550-629
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.54e-22
Family DIX domain 0.0025
Further Details:      
 
Domain Number 2 Region: 10-65
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000000000208
Family Calponin-homology domain, CH-domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000022469   Gene: ENSXETG00000010185   Transcript: ENSXETT00000022469
Sequence length 634
Comment pep:known scaffold:JGI_4.2:GL172675.1:3682921:3732410:1 gene:ENSXETG00000010185 transcript:ENSXETT00000022469 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FTAGENLSGIHLQPSSVQERRENVEKVLQFVASKKIRMHQTSSKDIVDGNLKSIMRLILT
LAAHFKPVSGRYTNHNVVGGTGKSQSASLDNHRPHSTAAMAQGAAAALAEVRQDMSRSGR
DIFRYRQRNSSFEEEIGNPYWSVRAMVKQYEGNSSPETLRCFNSLASPSPVHSAKSEVNE
TACDEKELAVIQSEESIAKRANGTEDSPLCHADLQCTSPVIYPESSWEDRLLEQQDHLEK
EMEEAKKMISGLQALLLNGSLPEDEQQSLFTLREDGACPEEQLVIIKSRLDQSMSENQSL
KNELLNYKQENRNLQGIKDALQQRMAHQESSVLQLKQELLRANMDKDELQSQNVDLQRKM
EERSQLAAEYKKELTQKEWLIQQLQGKLDESHRKLSEANYQKTDLQKELDHRKALLQQYM
NGEDDQVSDYMSHPAQTNGFMQSAGKVPSREPAQQRTANDLQLVRDALRSLRNSFSGHDP
QHHTIDSLEQGISSLMDRLHAIETQRRHDRKKARSKMQGSKGINEYRDSWPPNTTMPHSQ
STPVMGNSNSSTKVLYFTDRSLTPFMVTIPKRLGEVTLRDFRAAIGREGSHRYHFKALDP
EFGTVKEEVFHDDDIIPGWEGKIVAWVEEDHGNI
Download sequence
Identical sequences F6ZP16
ENSXETP00000022469 ENSXETP00000022469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]