SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000022718 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSXETP00000022718
Domain Number - Region: 5-52
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00689
Family Calponin-homology domain, CH-domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000022718   Gene: ENSXETG00000010321   Transcript: ENSXETT00000022718
Sequence length 425
Comment pep:known scaffold:JGI_4.2:GL172663.1:1619729:1643998:1 gene:ENSXETG00000010321 transcript:ENSXETT00000022718 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSYRDLRNFTEMMRALGYPRLISMENFRSPNFPLVAEVLIWLVKRYEPHTDIPVDVDTEQ
DRVFFIKAVAQFMATKAHIKLNTRKLYQADGYSVKELLKITTVLYNAMKSKGMESTQLED
QETSTFKFNLGSKISDLKMARQLASEITSKGATLYDLLGKEADLREQRTAAIARPLEMND
TEKVLRTSIKEVLEQVQKMKDLLSNVASDEQNLEAKIEKRKQELERNRKRLQTLQTVRPA
FMDEYEKIEEELQKHYETYLDKFRNVCYLEQQLEDYHRVEQERFEEAENTLRLMQSKLRE
EENRLHKNGNNNDDSDIEFQEDEGSDDMDPMERRTVKPNNGRMVTIQGRSSSHIVGTMNG
GESEDEDDSDDSEIDVDDEDDEEEDEDDDEEDIMRVRGHNKEISLGKASRRAQKADSLVE
SDNDF
Download sequence
Identical sequences Q05AZ5
NP_001016969.1.99540 8364.ENSXETP00000022718 ENSXETP00000022718 ENSXETP00000022718 gi|116063467|gb|AAI23086| gi|62858885|ref|NP_001016969|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]