SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000023148 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000023148
Domain Number 1 Region: 4-206
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.8e-71
Family Calponin-homology domain, CH-domain 0.00000254
Further Details:      
 
Domain Number 2 Region: 3049-3172
Classification Level Classification E-value
Superfamily EF-hand 8.67e-53
Family EF-hand modules in multidomain proteins 0.000000726
Further Details:      
 
Domain Number 3 Region: 3174-3270
Classification Level Classification E-value
Superfamily EF-hand 3.4e-40
Family EF-hand modules in multidomain proteins 0.00000424
Further Details:      
 
Domain Number 4 Region: 965-1121
Classification Level Classification E-value
Superfamily Spectrin repeat 2.95e-27
Family Spectrin repeat 0.0026
Further Details:      
 
Domain Number 5 Region: 2022-2180
Classification Level Classification E-value
Superfamily Spectrin repeat 1.08e-24
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 6 Region: 2601-2756
Classification Level Classification E-value
Superfamily Spectrin repeat 8.23e-21
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 7 Region: 3250-3333
Classification Level Classification E-value
Superfamily RING/U-box 5.18e-20
Family ZZ domain 0.0092
Further Details:      
 
Domain Number 8 Region: 311-417
Classification Level Classification E-value
Superfamily Spectrin repeat 7.59e-20
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 9 Region: 2716-2844
Classification Level Classification E-value
Superfamily Spectrin repeat 4.84e-19
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 10 Region: 1181-1336
Classification Level Classification E-value
Superfamily Spectrin repeat 8.23e-18
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 11 Region: 2866-3003
Classification Level Classification E-value
Superfamily Spectrin repeat 1.83e-17
Family Spectrin repeat 0.0057
Further Details:      
 
Domain Number 12 Region: 386-526
Classification Level Classification E-value
Superfamily Spectrin repeat 3.66e-17
Family Spectrin repeat 0.0035
Further Details:      
 
Domain Number 13 Region: 2431-2543
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-16
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 14 Region: 479-636
Classification Level Classification E-value
Superfamily Spectrin repeat 3.14e-16
Family Spectrin repeat 0.0041
Further Details:      
 
Domain Number 15 Region: 1596-1741
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000264
Family Spectrin repeat 0.0054
Further Details:      
 
Domain Number 16 Region: 681-798
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000366
Family Spectrin repeat 0.0028
Further Details:      
 
Domain Number 17 Region: 747-902
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000746
Family Spectrin repeat 0.0084
Further Details:      
 
Domain Number 18 Region: 2172-2290
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000816
Family Spectrin repeat 0.0087
Further Details:      
 
Domain Number 19 Region: 1792-1930
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000168
Family Spectrin repeat 0.0061
Further Details:      
 
Domain Number 20 Region: 3011-3048
Classification Level Classification E-value
Superfamily WW domain 0.0000000000401
Family WW domain 0.00014
Further Details:      
 
Domain Number 21 Region: 2257-2387
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000111
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 22 Region: 1503-1609
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000014
Family Spectrin repeat 0.01
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000023148
Domain Number - Region: 1308-1402
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00647
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000023148   Gene: ENSXETG00000010561   Transcript: ENSXETT00000023148
Sequence length 3651
Comment pep:known_by_projection scaffold:JGI_4.2:GL172707.1:2353484:3161892:1 gene:ENSXETG00000010561 transcript:ENSXETT00000023148 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SQFGKHPIEDLFSDLQDGRRLLDLLEGLTGQKLVKEKGSTRVHALNNVNKALQVLQKNNI
DLVNIGSADIVDGNHKLTLGLIWSIILHWQVKDVLKGIMADLQQTNTEKILLSWVRQSTR
NYPQVNVINFTSSWSDGLAFNALIHSHRPDLFEWNSVLCQSALERLDHAFNAAQRHLGIA
NLLDPDDIATAHPDKKSILMYVTSLFQALPQQVSIESLQELDTLPRRMVTPEPHVKPYDQ
QHFSQHITVSVAEGSVHTPSPPPKPRYKSYAYTQAAYVMYPDQKSRPFPQQQLEGFDNRP
FGTLVREPQADLESYQSSLEEVLSWLLSAEDILQSQKTISNNVEEVKDQFHTHEGFMMEL
TSHQGNVGNVLQAGSQLLVTGKLSDDEENEIQEQMNLLNTRWESLRLASMERQSNLHRRL
MDLQNQQLQQLSDWLSQTEERTRKMDAELGPDLEDIKRQIEEHKVLQDDLEQEQIRVNSL
THMVVVVDESSGEKATADLEDQLQHLGNRWAAICRWTEDRWVFLQEILLKWQRFAEEQQC
LFDVWLTEKEEAVNNINTASFKDQNEMRSNLRKLAILKGELEMKKTTMDTLYSLNQDLTS
ALKNKSVSQKHEARLENFTQRWDNLVQKLESTSKQISQAATTTQTSLTQTTVKETVTMVT
TREEILVKHAKDELPPPPPQKKRQILVESELRKRFDVDLTELHSWMTRSEAVLQSSEFAV
YRKEGDLTDLTKKVKAIEKEKPDKHRKLQDANRNTQALVEQMLSDGVNADSIKQSSQHLN
SRWTEFCQLLSERISWLEYQNSILAFYSQLQQLEQKVISAENWLKAQTQPTSETVKMHLA
KCKDEVARLSALKPEIGSLQVQGTELKEKEQRPMFLEADVAAFVNHYNQVLSSLQSREKQ
LQNILDSLPPTQYTEKMSTILMWIQQSETKLAIPQVTVTECEIMEQRLRELKALQSSLQE
HQADMNYLSKTAEELSRKAPTDVKQKYLTEIDLTQNRWKTLSNQLVGQCQKLEELLSTLK
QFQNDMKTLKKWMAEVNVFLNEEWPALGDFEALEKQLEQCSALVNDIQTIQPSVTSVNDV
GQKLISKAEPVYSSKLKQDLKNLNDQWDHICRQANAKKAALKGGLDKTISLRKDLSEMQE
WVTQAEHEYSERDFEYKTPEELQKALEELKRATEEAAQKEDKVKLLKDSVNNFIATAPPA
AHEPLKKELEVLVTNYERLCSRLNGKCQTLKEVWACWCELLSYLEAENKWLDEVEAKLKT
TENVKGGAEEISEALKSIEKIMKHPEDNRNQIRELAQTLTDGGVMDELINEKLEKFNTHW
EEVQQEAVRRQKVLEQSIQSAQETDKAIRMIQEALNTTDRQLTAYIADRIDAAQVPQEAQ
KIQSDLMSHEISLDEMKKRNQGKEMSKKVLSQIEIAQKKFQEVSTKFRLFQKPANFEQRL
IESKRILDEVTFELPVLEIKSIEQEVVQTQLDQCMVSCWQISKVSGHVLFMLFISRCIIQ
NKSNSRAQVLNGRVTSLKISQNEMKKKVTEGKQNLEKCLKLSRKLRKEMNSLTDWLAATD
VEVTKRSAVEGMPSNLAEEIGWSKSTQKEMEKRQQQLKNVHDIGDSLRTVLGGEHNLVDD
KLSLLHSNWVAVTSRAEEWFRLLLQYHSEMESFDQDVATIKTWMNQAESLLDESEKQKPQ
QREETLKVIKSELNDMQPKKDSMHENAEELMTNRGAHCRKMVETKLSDLDKRFNAISQRI
KSGKALVSSKELEQFNSDMQKLLEPLEAEIQLGVNPTEEDFNKDMSEDNEEPVKELLLRG
NNLQQKITDEKKCEEIKLKQQLLQSKHNTLKILRTQRRKKALEISHQWYQYKRQADDLLK
CLDDIERKIASLPDPKDNQKLKEIDGELEKKKEELISVHRQAESLSKEGAGKAVEPTLIQ
LNKRWKEIESKFAPFRRLHYAQIHNLMVNSFVNSTKKLPINLSYVPDNSTFITIVYYSFQ
TLDHVPQFFNVISFCKEKFQNIFILKNSLKNIKDSLGRLSGQMEVIQNKKKAVMQCASPR
ENERIQDKLSDLNFEWENVNKLYKDRQMKHDRCMEKWMTLQDNMNHFNHWLNEAELILSD
IPVPTNWQEWNRKWWVLQELEDGIGQQQTFVRALNVSGGEIISQSSPTETADIRDKLESL
NSRWHIVNRKINERRRRLEEEKKKLYGLQEDLNKFCIWLEDAEGIARQPTEPGNELQLNE
LYEKVKFTAEELLPRKEFLKQLNEAGGTALGSTTISPKEKKKIESGLKEANQRWIKVSKD
LHDKQKEIEDELKNLSLFELQLNQLTLWVSSVKDQLQFYNQVGRPGAFDIKETEEAILAK
QPHVEGILSKGHHLYTKEPAPYVLKQKLDDLQTEWNTVNLLLQELKRRPAVAAPAVVTMS
QGGGQTVSVVTQTLVTGSTVPSADMPSSLLLEVPALAEFNRTCAELTDWLTLLDRVLKAQ
IVTVGDVEEINEMIIKQKTTLQDLEKRRPHLEERITAAQNLKNKTSNPEARAVITDRIDK
IQNQWEEVQCHLQNRRLQLQEMLKDSNQWIEARHEADQVIEKAKNRTDSWKEISYTVEAL
KNQNSDLKQFSKELQQWQINVDAANDLALKLLRDYSTDDTRKVELMKDNINATWARINKR
VTERDAALEAALRLLQQFYLDLEKFLAWLTEAETTANVLQDATHKDGVLEDTRGLRELMN
QWQNLQEEIDGHTEVFHSLDENGQKMLRSLEGSDDGVLLQRRLDNMNIRWNELRKKSLNI
RSHLEASTEHWKRLHVSLQELLAWLQMKNEELKQQAPIGGDVPKVQTQIENHRAFKREIK
TKEPVIMNAIDTVRIFLDDQPSETMERMHQEPKEAQTEEQFRNISRVLQKQVDDVSTEWD
KLNLRSTDWQKKLDEALQRLQELQEAMDELDHKLHQAEALKGSWQPVGDLLIDSLQDHLG
KIKTFKAEIAPIKNNVNQVNDLAHQFDSTVIQLSPYNFSRLEDLNTRWKLLQVSIDERIR
QLHEAHRDFGPTSQHFLSTSVQGPWERAISPNKVPYYINHETQTTCWDHPKMTELYQSLA
DLNNVRFSAYRTAMKLRRLQKALCLDLLGLSAACEALDQHNLKQNDQLMDILQIINCLTT
IYDRLEQEHNNLVNVPLCVDMCLNWLLNVYDTGRTGRIRVLSFKTGVISLCKAHLEDKYR
YLFKQVASSTGFCDQRRLGLLLHDAIQIPRQLGEVASFGGSNIEPSVRSCFQYANNKPEI
EAALFLDWMRLEPQSMVWLPVLHRVAAAETAKHQAKCNICKECPIIGFRYRSLKHFNYDI
CQSCFFSGRVAKGHKMHYPMVEYCTPVSNNKRHKDAASIMLHSYIDKAYYFKHDLMLLFF
SPLVVTVVSSNPPTTRTVVLLWSLEAIPASSPQLSHDDTHSRIEHYASRLAEMENTNGSY
LNDSISPNESIDDEHLLIQHYCQSLNQESPLSQPRSPAQILISLESEERGELERILADLE
EENKNLQSEYDRLKEQHDHKGLSPLPSPPEMMPSSPQSQRDAELIAEAKLLRQHKGRLEA
RMQILEDHNKQLESQLHRLRQLLEQPQAEAKVNGTTYSSPTSSLQRSESSQPMLLRVVGS
QTSESMGEDDLLSPPHDSSTGLEDVMEQLNNSFPTARDKNVTGQRNSESDF
Download sequence
Identical sequences F7BS74
ENSXETP00000023163 ENSXETP00000023148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]