SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000024355 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000024355
Domain Number 1 Region: 526-572
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000523
Family TSP-1 type 1 repeat 0.00074
Further Details:      
 
Domain Number 2 Region: 101-137
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000772
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 3 Region: 45-93
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000667
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 4 Region: 481-520
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000168
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000024355   Gene: ENSXETG00000011133   Transcript: ENSXETT00000024355
Sequence length 572
Comment pep:known scaffold:JGI_4.2:GL172640.1:3029955:3048974:-1 gene:ENSXETG00000011133 transcript:ENSXETT00000024355 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLYWTLFLYLALHCCSCEKHPNATKTTLSHKRCRRSVASPPQPVDCDFSSWSDWSSCDP
CQKKRFRFAKLTQASQFGGEPCNRIDRQEEVCATRSPCRNTKKCEGFQCTETGRCIVRRL
LCNGDDDCGDLSDEKNCKSVPSSCSDDMEQYWGIENLASGINLFTNSREGFVLDHRYYAG
GCSPHYILNTKFRKPYNVENFIPESKGKYEFSLSEHESYSDYERSFLSGHAKQTSFGIGL
KIPGLFEIGFNYNDMKVKTFMERIKRFSHTKSKFLSARSTLQVAQYKLKSRNLMLHTEFF
QRVKQLPLQYVYGEYRDLFRDYGTHFITEATLGGIYEYTLILNNEKLKKEGYSLNDVQKC
AQAGFKIGANIEGIWLSAGMSAGACSGLLKEIGEKISSDKLVEDFVALVRGGASEQITTL
AYKDLPTQDLMQEWGDAVYYNPDIINIKSSPLYELVTAADFTGANILQENMKLALEEFQA
ETSSCSCVPCQNNGLAVFIENRCECICPLGFTGMACEITKRPVNVIDGSWSCWSSWTPCS
RRIQTRDRQCNNPSPQNGGNQCEGTNTDTRNC
Download sequence
Identical sequences F6R5H7
XP_002931633.1.99540 ENSXETP00000024355 ENSXETP00000024355 gi|301603975|gb|XP_002931633|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]