SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000024358 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000024358
Domain Number 1 Region: 539-584
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000484
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 2 Region: 87-128
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000013
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 3 Region: 35-108,492-530
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000722
Family Growth factor receptor domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000024358   Gene: ENSXETG00000011135   Transcript: ENSXETT00000024358
Sequence length 584
Comment pep:known scaffold:JGI_4.2:GL172640.1:3012420:3026792:1 gene:ENSXETG00000011135 transcript:ENSXETT00000024358 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIVMLYHALALWGYTASIGNMDLLLFRSIAAPQPEDCQLDQWSQWTSCFPCQQKKYRYRK
LLQPAKYEGRPCVGSLWASMACQTAQKCVPENNCGNDFQCRDSGRCIKRRLVCNGDLDCR
DSSDEEDCDAPEHETFCKTLFPIPGAEKSVRGINILTHEDTRNVIDHNYFGGQCEYIYNG
EWRELRYEPVCEQMYYSDEEKYFRKPYNFHIYQFLARADTKMSIEIYEDSKDVVNAVKRD
FSFNIGLTFGISVPEAPVGLELGLNYGLKTSFLKKITSFNQKNLEFVRMVTKIQTARFKM
RRNLLTLDEDTMQSLMELPDEYNYGLYAQFINDFASVSVPLSPMGAVYERSIRKSRDNIR
ASQITASMVSHCFGASVGLSVQTEFEEIIPSLKLSGDFCTKFERENQDNSSSSRAIKDVI
TYVIGGDSGSAGGILNVFDGRMYRYWGRSLKYNPAVIDFEIQPIYEGLQQTGLSGIEAKR
QNLKRAYNEYLSEFDPCRCGPCHNNGMPMLENNVCTCLCTAGFNGPSCENTLRKDVKADG
RWSCWSPWTQCQSGKRQRTRECNNPAPKNGGAWCLGKSLQSEPC
Download sequence
Identical sequences F6R5F4
ENSXETP00000024358 8364.ENSXETP00000024358 ENSXETP00000024358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]