SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000024926 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000024926
Domain Number 1 Region: 2-228
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.16e-90
Family Calponin-homology domain, CH-domain 0.00000173
Further Details:      
 
Domain Number 2 Region: 2147-2267
Classification Level Classification E-value
Superfamily PH domain-like 1.08e-34
Family Pleckstrin-homology domain (PH domain) 0.0000103
Further Details:      
 
Domain Number 3 Region: 247-368
Classification Level Classification E-value
Superfamily Spectrin repeat 3.53e-33
Family Spectrin repeat 0.0000756
Further Details:      
 
Domain Number 4 Region: 645-796
Classification Level Classification E-value
Superfamily Spectrin repeat 4.73e-31
Family Spectrin repeat 0.00062
Further Details:      
 
Domain Number 5 Region: 967-1122
Classification Level Classification E-value
Superfamily Spectrin repeat 9.29e-30
Family Spectrin repeat 0.0000255
Further Details:      
 
Domain Number 6 Region: 1179-1332
Classification Level Classification E-value
Superfamily Spectrin repeat 1.31e-28
Family Spectrin repeat 0.00056
Further Details:      
 
Domain Number 7 Region: 860-1015
Classification Level Classification E-value
Superfamily Spectrin repeat 2.74e-28
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 8 Region: 1603-1756
Classification Level Classification E-value
Superfamily Spectrin repeat 6.48e-28
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 9 Region: 1495-1651
Classification Level Classification E-value
Superfamily Spectrin repeat 2.75e-27
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 10 Region: 1814-1968
Classification Level Classification E-value
Superfamily Spectrin repeat 1.51e-23
Family Spectrin repeat 0.0022
Further Details:      
 
Domain Number 11 Region: 481-589
Classification Level Classification E-value
Superfamily Spectrin repeat 6.6e-22
Family Spectrin repeat 0.00043
Further Details:      
 
Domain Number 12 Region: 378-479
Classification Level Classification E-value
Superfamily Spectrin repeat 6.02e-20
Family Spectrin repeat 0.00042
Further Details:      
 
Domain Number 13 Region: 1340-1438
Classification Level Classification E-value
Superfamily Spectrin repeat 6.33e-17
Family Spectrin repeat 0.00073
Further Details:      
 
Domain Number 14 Region: 1974-2034
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000023
Family Spectrin repeat 0.002
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000024926
Domain Number - Region: 1127-1198
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00604
Family Spectrin repeat 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000024926   Gene: ENSXETG00000015170   Transcript: ENSXETT00000024926
Sequence length 2322
Comment pep:known scaffold:JGI_4.2:GL173264.1:162847:198846:-1 gene:ENSXETG00000015170 transcript:ENSXETT00000024926 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SDEREAVQKKTFTKWVNSHLARVTCRISDLYNDLRDGRMLIRLLEVLSGEQLPKPTKGRM
RIHCLENVDKALQFLKEQKVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETED
NKEKKSAKDALLLWCQMKTAGYPNVNVHNFTTSWRDGLAFNAIVHKHRPDIIDFDTLKKS
NAHHNLQNAFNVAERELGLTKLLDPEDVNVDQPDEKSIITYVATFYHYFSKMKALAVEGK
RIGKVLDQAIEADQLIENYEGLASELLQWIEQMIITLNDRKLANSLSGVQNQLQAFNTYR
TVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYTPREGKLISDINKAWERLEKAEHEREL
ALRNELIRQEKLEQLAARFDRKAAMRETWLSENQRLVAQDNFGVDLTAVEAALRKHEAIE
TDILAYSERVQAVNAVADELEAENYHDVRRILARKCNVIRLSDYLRELVTARRQRLHMNL
ELQRMFQDLHYLMDWTEDMKGRLQSEDYGKHLHGVEDLLQTHTLVEADIAVQAERVKSVT
AVAQKFMTEDEGYKPCDPELVRNRVHLLEQRYAELCNLSAARRSKLEESRRLWKFFWDMG
EEEAWIREQSRLLLSDDYGKDLTSSLRLISKHNAFRGEMSGHRGPLQQTVAEGEELISKG
HFGAGEIEERIKEVKGQWTEMEALAEDRERRLREAYSYYQFQADANDAEAWILDTLRLVS
TSEVGHDEYSTQTLVKKHKEIEEEILSHRPAIDALHEQARGLPPAYSHSPEVDGRLPALE
QRYEELVALAAHRKQACSETISLCFYKGFSDGSGSVLICIRTSLMNPNKHVPVGKISENN
IIHSYWFETLEAEMNNLASRIASVNEVAGQLLTTDQRNENSIRDMQDQLNSRWNEFRKLV
DQKKGALDSALDIQNYHLECNETVCWMREKTKVIESTQSLGNDLAGVTALQRKLTGMERD
LKAIQGKVGDLRSEAEKLADGHPQKAPAIIGRLSDIDETWGELKDTMKRREETLGEASKL
QGFLRDLDDFQSWLSRAQTAVASEDVPADLAEAERLLAQHEGIKNEIDHYGADYHRVRDV
GEEVTRGQTDAQYMFLQQRLKALDTGWNELGQMWENRHQLLSQGHSFQQFLKDTKQVEGF
LNNQEYVLSHTEMPSTLQAAEAAIKRHEDFLTTMDANEEKIQGLVESGRKLIEEQNVNSE
KIQEKVTSIDERHKKNQKTASEVLTRLKDNRDLQHFLQDCQELTLWINEKMLTAQDVSYD
EARNLHSKWQKHQAFMAELASNKDWLDKIDKEGQQLMSEKPELEPVVREKLDTLHKLWND
LESTTQSKAQCLFDANRAELFTQSCSALESWLQNLESQLQSDHYGKDLTSVNILLNKQQM
LENQMEVREKELEAIQSQAQALGQEDANIVEVDSKHKDVADKFSKLRAPLNKRRKLLLAS
KEGHQFNRDLEDEILWVKEKMPMAISTDHGKDLPTVQLLIKKNQTLQKEILGHQPRIDDI
LERGKSMIQDSSLDPQEIEERLGLLKSTWEELAAEGGKRHARLEESLAAQQFYADAAEAE
AWMGEQELHMMSEEKAKDEIGAQAMLKKHLVMEQALDDYADNIHQLANSSRDMVSRGHPE
SDRITLRQGQVDKLYASLKDLAEERQGKLQEHHRLCQLKRDVEDLEHWISEREVVAASHE
LGQDYEHVTMLRDKFREFSRDTSNIGQERVDAVNLMADDLISSGHSENATVADWKDQLNE
AWADLLEMIDTRSQMLAASYELHRFYQDAKETLGQIQDKQKQIPEETGRDLNTAEAMQRM
HTAFEHDIQALSAQVKQVQEDASRLQKAYAGEKAADIHRHEQAVSEAWGELQNASGARRQ
LLLDTVEKFRFFRMVRDLMLWMDDINLLIDAQEKPRDVSSADLVIQNHLGIKAEVDARAD
SFTTCIDLGNSLLEKNHYASDKISEKLEQLQERRQETENKWKDKMAWLRVVHEVLMFGRD
ASVAEAWLASQEPIVRSSELGGNVDEVESLIKRHEAFQKAVSTWDERFVLLEKLTTLEEI
EMRRKREEEERKKRPPTPPLPVEEPREEVVKTQVSQTIEGEQVSVNGLCTESDSPQSICE
GPEQSDVTNGARTEVITKDGSPTPSPQLVARPTFSPINLQYSTLPSSPTEPLASEQMEGM
LHRKQEMDSHNKKAANRSWQNVYCALKRGSLGFYKDAKSAASGVSYHSEPSVQLNGAQCS
VAHDYKKRKNVFKLSLLDGKEYLFQAKDEAEMSSWMRVINASLTSSPGDPSDHSPGIMKG
MTRAMTMPPVSPNSGTEGSVTLRNKDGKEKDREKRFSFFKKK
Download sequence
Identical sequences F6YQ80
ENSXETP00000024926 ENSXETP00000024926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]