SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000025166 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000025166
Domain Number 1 Region: 115-391
Classification Level Classification E-value
Superfamily L domain-like 3.91e-49
Family Ngr ectodomain-like 0.00094
Further Details:      
 
Domain Number 2 Region: 411-710
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 1.65e-40
Family Rhodopsin-like 0.0013
Further Details:      
 
Domain Number 3 Region: 41-78
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000942
Family LDL receptor-like module 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000025166   Gene: ENSXETG00000011511   Transcript: ENSXETT00000025166
Sequence length 712
Comment pep:novel scaffold:JGI_4.2:GL173058.1:293111:363560:-1 gene:ENSXETG00000011511 transcript:ENSXETT00000025166 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYFAFLLFLFCDIILRSPITLAFYLYFAESLMIPSNLDSGICPLGQFPCGNLSVCLPQLL
HCNGHKDCANGADEENCVDNSGWPKLFDTIQSARGNRKMQDEETHECMLDIYPEPCECWR
RMVNCSSQGLHSVPPVSSNVTALNLKDNKIKTLHDGIFSRYQDLEKLLLQNNELHDISRL
AFSGLFKLKMLFLSQNRIRSLKAGVFKDLRSLEWLILDNNQVSKIVPGTFSGLESLYFLD
MLNNSIREIPRNSICEEMPHLNWLDLEGNQMQTIHSSVFQECITVLSLRRNNIRKIRKGA
LSQMNKLVDLDLSMNQIVELSPSLFTNLRDLQQLNISFNPLQHIQPNQFDLLSNLQSLNM
EDIEIPNIHNRMFSSLVNLSHIYFKKFQYCSYAPHVRSCKPNSDGISSFENLLANILLRV
FVWVMACVTCFGNLFVICMRSFIVTENCQHTMSIKSLCCADCLMGFYLFCLGAFDIKFQG
EYNKHAQAWMESWECKLVGSLAMLSSEVSVMMLTYMTLEKYLCIVFPFSHFRAGRGQTLC
TLTAIWGLGFFITVIPFFSYDTFGNFYGRNGVCFPLQSDSTEKYGARGYSVSIFLGLNLL
AFVTIVFSYSSMFYSIHKTGAKTAERSVLSREVTIAKRFFFIVFTDALCWIPIFLLKAVS
LTEAEIPGTITSWIVIFILPINSALNPILYTLTTSSFQEKLKQCLQSKRQES
Download sequence
Identical sequences F7DEB8
ENSXETP00000025166 ENSXETP00000025166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]