SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000026099 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000026099
Domain Number 1 Region: 128-226
Classification Level Classification E-value
Superfamily Immunoglobulin 5.09e-31
Family V set domains (antibody variable domain-like) 0.00012
Further Details:      
 
Domain Number 2 Region: 1-100
Classification Level Classification E-value
Superfamily Immunoglobulin 1.28e-26
Family V set domains (antibody variable domain-like) 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000026099   Gene: ENSXETG00000022356   Transcript: ENSXETT00000026099
Sequence length 232
Comment pep:novel scaffold:JGI_4.2:GL174312.1:6066:11991:-1 gene:ENSXETG00000022356 transcript:ENSXETT00000026099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVSLTQPVSESVKPGETVRISCTLSGYSIGDRNVYWFQQKSGNRPRYLLWFQADSNKHQG
AGVPDRFSGSKDSPNNVGYLTIRGALLEDDADYHCAICSVGYFSRSCIVNYCSSKIFSAK
SGNGCAGQYVLTQPASVSVSVGGTVTLTCEGDDIGSKAVQWYQQMLPSAPRLIIYVDSNR
PDGIPERFSGTNSGNTASLEISGAQAGDEADYYCQERGGSGDLYGGRSVHRE
Download sequence
Identical sequences F7B9K5
ENSXETP00000026099 ENSXETP00000026099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]