SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000027049 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000027049
Domain Number 1 Region: 1-120,151-259
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.75e-74
Family Calponin-homology domain, CH-domain 0.0000311
Further Details:      
 
Domain Number 2 Region: 8035-8190
Classification Level Classification E-value
Superfamily Spectrin repeat 2.28e-20
Family Spectrin repeat 0.0043
Further Details:      
 
Domain Number 3 Region: 7815-7939
Classification Level Classification E-value
Superfamily Spectrin repeat 1.58e-19
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 4 Region: 8412-8526
Classification Level Classification E-value
Superfamily Spectrin repeat 3.8e-19
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 5 Region: 3319-3440
Classification Level Classification E-value
Superfamily Spectrin repeat 8.23e-19
Family Spectrin repeat 0.0097
Further Details:      
 
Domain Number 6 Region: 6954-7096
Classification Level Classification E-value
Superfamily Spectrin repeat 2.02e-18
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 7 Region: 7407-7537
Classification Level Classification E-value
Superfamily Spectrin repeat 4.45e-17
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 8 Region: 7078-7210
Classification Level Classification E-value
Superfamily Spectrin repeat 2.45e-16
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 9 Region: 3869-4010
Classification Level Classification E-value
Superfamily Spectrin repeat 3.6e-16
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 10 Region: 4489-4647
Classification Level Classification E-value
Superfamily Spectrin repeat 4.25e-16
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 11 Region: 1612-1740
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000123
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 12 Region: 3102-3227
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000041
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 13 Region: 6742-6883
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000366
Family Spectrin repeat 0.0092
Further Details:      
 
Domain Number 14 Region: 2662-2797
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000048
Family Spectrin repeat 0.0079
Further Details:      
 
Domain Number 15 Region: 8490-8634
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000108
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 16 Region: 1392-1524
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000114
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 17 Region: 1694-1848
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000149
Family Spectrin repeat 0.0026
Further Details:      
 
Domain Number 18 Region: 2444-2570
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000155
Family Spectrin repeat 0.0066
Further Details:      
 
Domain Number 19 Region: 7498-7648
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000202
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 20 Region: 541-677
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000324
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 21 Region: 7943-8053
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000518
Family Spectrin repeat 0.0079
Further Details:      
 
Domain Number 22 Region: 3789-3905
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000798
Family Spectrin repeat 0.0039
Further Details:      
 
Domain Number 23 Region: 4271-4427
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000108
Family Spectrin repeat 0.0088
Further Details:      
 
Domain Number 24 Region: 5695-5813
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000772
Family Spectrin repeat 0.006
Further Details:      
 
Domain Number 25 Region: 7605-7756
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000984
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 26 Region: 2812-2930
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000122
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 27 Region: 5916-6051
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000212
Family Spectrin repeat 0.0075
Further Details:      
 
Domain Number 28 Region: 7283-7400
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000266
Family Spectrin repeat 0.006
Further Details:      
 
Domain Number 29 Region: 1497-1606
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000561
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 30 Region: 5076-5194
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000576
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 31 Region: 2040-2173
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000458
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 32 Region: 854-996
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000509
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 33 Region: 5460-5577
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000011
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 34 Region: 3014-3136
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000273
Family Spectrin repeat 0.0039
Further Details:      
 
Domain Number 35 Region: 1069-1207
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000345
Family Spectrin repeat 0.0085
Further Details:      
 
Domain Number 36 Region: 6513-6620
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000137
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 37 Region: 2338-2455
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000144
Family Spectrin repeat 0.0067
Further Details:      
 
Domain Number 38 Region: 4942-5054
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000471
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 39 Region: 1957-2072
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000576
Family Spectrin repeat 0.0081
Further Details:      
 
Domain Number 40 Region: 3577-3680
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000662
Family Spectrin repeat 0.0075
Further Details:      
 
Domain Number 41 Region: 6671-6780
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000017
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 42 Region: 3655-3779
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000259
Family Spectrin repeat 0.0076
Further Details:      
 
Domain Number 43 Region: 4617-4754
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000266
Family Spectrin repeat 0.016
Further Details:      
 
Domain Number 44 Region: 5590-5674
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000034
Family Spectrin repeat 0.014
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000027049
Domain Number - Region: 3233-3309
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000388
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number - Region: 6060-6174
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000719
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number - Region: 3981-4114
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00127
Family Spectrin repeat 0.009
Further Details:      
 
Domain Number - Region: 3445-3519
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00127
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number - Region: 2580-2652
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00137
Family Spectrin repeat 0.016
Further Details:      
 
Domain Number - Region: 5270-5364
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0022
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number - Region: 6362-6464
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00824
Family Spectrin repeat 0.02
Further Details:      
 
Domain Number - Region: 4853-4970
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00981
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number - Region: 6196-6258
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0964
Family Spectrin repeat 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000027049   Gene: ENSXETG00000012367   Transcript: ENSXETT00000027049
Sequence length 8775
Comment pep:known scaffold:JGI_4.2:GL172842.1:560301:752219:-1 gene:ENSXETG00000012367 transcript:ENSXETT00000027049 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DEQEAVQKRTFTKWINSHLAKRHPPMVINELFEDIKDGTKLIALLEVLSGQKLPCEQGRQ
LKRIHWVANIGAALKFLEGRRIKLVNINSTDIADGRPSIVLGLIWTIILYFQIEELTSNL
PQLHAMSSSTSSVDSVVSSEAASPPIKRKIVNKIQGSAKKALLRWVQYTAAKRLGIEVKD
FGPSWRNGIAFHSVIYAIRPDLVDMDIEKLKRRTNRENLEEAFSIAENELGIPRLLDPED
VDVDKPDEKSIMTYIAQFLKHYPDPHHTSLDGQEDSARLQFPENSSSIYKFEREDRIVLR
DMKVWLEQFEKDISRAQMVESSPQDRYQSFKQYRVQYEVKRKQVEALIHPLGKDGKLSLD
QTMVKQAWEKVSSRIFDWHLQLDKSLPAPLGTIASWLYRAEVAMREEIVVQQSHEETANI
MHRKLEQHKDVLKNLDGYKKAFQEIHRSRSVNGIPVPIEQLEDMAERFSYVASSSHLHMI
KLEFMELKYRLLALLVLAESKLKSWIIKYGRRDSVELLLQNYIAFIDGNRFFEQYEFTSQ
SLKQAAEMYVKADGSADEAENVTKFLNETTVQWKNLSVEVRSVRSMLEEVITNWDKYSNT
VASLQAWLEDAEKMLNQPEHAKKDFFRHLPHLIQQHTTMNDAGNFLIETCDETVSKDIKQ
QLLLLNGRWRELFMEVKHYAREDEYERAKKEYADGLIALAAFAEGGNERISTPLEVSFLN
VKMFVQDLEDIKQKMPIIEAQYKSVTRMAQLLTKESSQAEANEMLSAVSRIKDQLNKIRE
HYPPLLYESQQLLTPLGEFEGHMTNFYECLEKIHGIISVADLDMQTASVFKQKQRELLSC
QESCKKTLIIIEKYSQAVHKALTISKSLHHFDRCVLQKKLTDAQAAYQNALKKTTEWRKK
VDTGNMMMKNFEESRAELEKVLKTAEMYFKETGNPSDLLKKHTEFFGQLDQKVLNAFLKA
CDELTDILPEEDQQPLQDTVRKLHKQWKDLQSEAPYHLLHLKIELEKNRILTTVEESKVE
LARENKMLPIEGSEKIIREHRTFFSEKGFYHLCEKRLHLIEELCLKLRDRDPVKGVLESS
KTAVRDINSQIESTHLKLMEHPDKWKDFRSRFSELSGWLIEKEKQLKKIRSSATDSTRYG
QFKDLVEEIRRDVTKQEDTLKFLKDKITALSDISVEAEVTKQNKELARISADFKEFLEHL
AEIEKLLSTVRDFVQCKEQVQTVLSQLITSTRDAQSEAEKILDTESFTEAQELLLLYQQN
IKKIQSDKKEVQQQITQAKQLQGERGLSGPVQEDLIRMEVELENVEQTMVKQEEHLQVTM
NKWEEIESGKESVKLCLKQIGPIVDRSINFNTLESLSSEIQQAKEVCKQSEDTSVQVEDL
VKKSFEIQLGAKSKQSLQQQTKSIQEKVKKVKESVKENITKMETVKMKWEDFNLDFEAHS
AWISEKEKELTTLESSPLSPEMQIMQIQEILKQLNSQSNEITNLETKCQSFAQFITSAEM
ARIRARMSQISKHWTGLNDHAHRLEESILGNAVQQQKFKETFREVQNSLNEIEDNLSQPV
TNCSSAAETYRVLHSHQELCHNVESIKNSILSLTTSARKLITKDKAMQETLTLQQKQETL
SAQAKVRLNLLEQLLTQWQRQERDFSSFVTWLQRSETLVTHQDDGFPADKGKLEAEVKAM
KDLQYEVQAQNQRYKGLMETSKSLYNTCTSENLEEIKERLQELTERWNALPRSISQRLQS
VESALQEHQKFDSMVLEFSLWIKKFLKELHDTAEINTSDYEAALHINKNHVTEVKRQEKE
LQSLKGQLENLWSFTSSEEHLVLQGRVGDCIQLYEEAIQITNRREDSLPKLGEFLQIHTE
STAVLQHLKETVNTTASLDKVKSESLAKELNGIVAEIENLTSLSVGLDASLTKAQYHLRS
GATNQRTSCRALADNLSLELEAVQTYFGSKQSEAEALGALWKSFIECREKLLKCIEDIEE
KADKEEMKEPTLQALQQRLKFFNELEEEMNSHKHEKQWLMDKAKLIAQKDLVMAAEADKV
FNGLKMTWDDTKRLISESQEQCSELINLMKGYQHSNATIIKLIENAENMITIKSMLKDQE
DIRRTIAKHESTKNELGENQKELDEFTNKGKQLLLDLKRVHGCDSRPIKQDMDSSMDKWL
DVLERIDDNLERLRVSLTLWEDVLLINDEIDDWSSSSISQMSESISNLNNSQHMKTCLED
FQNDVLTMVLLKSQSFQIIDSIHDENSTCQNTINFGHIACSISRAIVIHQETIMCMLTLQ
DFTDISNCTSSKINGEFYQWMQYAVMESSESTSYSHTCKFSLVMQDIQMELQTQQSSIDT
TQENLNSLCRKYRSMELETLGGSVTALIKKYEAANQLCLRSQTNLQDTLEKRFYESMREF
EEWFEGVKSGVREYSDWSGDSRTLEGKIQHMQGILDSITEGESKLDVALEEGEKLYFCLP
KPVMVSIQEQIAKAQKDFQSFKKQCLKDKQALEDCISELGSFEDQHKKLSLWIHELEERL
RTETLGESKQHIPEKKNEIQKVENFLEELLASRESFDRLSQRAQTLNEDGLGGGQEVRLA
SQLHTSYQNLLKTIKEKLRICQVALQDHQIFEEALQTTWSWLKDMQDKLITTESTVGSKS
TLEKRLLQVQEMLLVKGEGEVKLNLAIGKGEQAMKSSNKDGQMVIQMQLQTLMDVWGTVN
NTATHCLSGLEAILGQWNEYTERKTQLELWLEMTDQKLEQPVQPQNGLKEKFTLLDYIQA
IVSDIEDHSTTLHHLIEKAKELHQRTEDDAFSDSVQNELRTHFNDILTVAKEKMRKVEDI
VKDHLMYLDAVHEFTDWLHSAKEELHRWSDASGDVPAIQKKLTKIKELMDSRQTGAERLS
RIETLSPAVKQNTTDSGCEQMDNEIHSLQADWKQWEDSICHSQKALDGLLNQMAISEQEF
SNQVSKLEDAIQDFSFFLEKWTQKLNQGEGKDTDKEIVEQWHRQKDVLTALNDAEHVTDE
LKTKLNDLCRFSKDLSIYSAKVSSLIKEYNSLCLQASKGCQNKEQVLQQRFRTAFRDFQQ
WLVNAKVTTAKCFDIPQSVSEVSANLQKIQECLSESENGQHKLQTVMTRGELLYSILTEE
KAKVTRQKMLTAKDDWKGFISSLHQKESALENLQIQMKDFETSADPVQTWLSATEKIVRD
SNNRLHDLPSKKKEQQKLQSILEEISSHEPQITRLKEKAQQLREGQSACKSFAHRGSQLS
AQYLALSSLTKEKMSRMDRIVAEHQQFSQGMIELEDWISEAIHMLQSYCHPTADRSVLDS
RMSKLEALLLVKQEKEIEMNMLLSRGESVVRNTSPEGAPAIQNQLQDLKNTWASLLLSCI
QCKSHLEGALSKWTSYQDDVRQFSTWMGRAEERLHDMVKQYAELREKTAAQSKIKLLNEE
ILSHSSLLEKIEVKGASMSENYVTQLELQELQENYSTLKEKAKEAIFKVDKLVRAHQDYQ
QGLKAFEEWLQQENEKLNCNMDLDGDTPRHEITLRELQVYIFHCISLTKLQYNTLTEQTG
LVLSIKGTNGRRPLPCRSKWSSFRKMLLETQKLVINKXKHMESKFQKTDQWLTSIEGKVN
IRTSRQSDRATKEAQLYQMKKWHDEVLVYKDEVEDVGTLAQRVLEEGKSSSRVGSLATML
TSRYQAVILHILEQIKFLEEELRYAEESEVAIRSYADWYGEARRKFLTLTSDIGVVDKTT
MEKKKKNLEFLLSDMDAGQSLLKSAREKGERVLKYLESTEADQLETEINSHVQRQEELTY
SIRREHTALEKTFHLAKEFSDKYRQQAQWLSEFQAILQTSVEPKTELYEKKAQLAKYKSI
QQTVFSHEPSIKLVIEKGEALIGVTFDSTIGERIQKLQKDFQELCILVKTTVADLEESVK
EHDEYNCELQDVEKWLLQMSSRLVAPDLMESGNLEIITQQLANHKAMMEEIAGFEERLNS
LKSKGDKLVFYCAEHLQAKFKQSIQAHLQGIRDSYSAICSTVQRVYLSLENELQKHVSHQ
DTLLQCQAWFSAVQPEIKFGIKAPLSLAEATKQAKHYRTLQEQANTYLDLLCTACDLSDV
TVKNAAIDIQQTKQTIEQRMIQSQELTSGWEEVMQIKAELQAYFQDAGQQLQNMKRRRAE
LEIKLAQNMVSQMKDFNQKLQSKQHKITFLTEKVNKLTNGQESPEHVEIGQLSNKWLDFC
FQANNLLLQREEDLQRTRDYHERLNIVDVFLEKLATEWDNLARRSDTESTATHLEALKTL
VSILQERRFALEDLKDQKQKLIDHLNIDDRELAKEQTRHFEQRWTQLENLVKNKILSCVT
TLEELGLVNSRLQELTEWAEDQQPSISEALKQSPPPELAQNLLMDHLSICNEVETKQVLL
KTLMKDADRIMGNLGLNERQQLQKALVDSQNHIDCLSDLVNQRKKHLNKALSEKTQFLMA
AYQTLNQIYQHEKKVTLQEHICLFPDDVNKQIRSCKNAQASLKAPQSDINALWNQGRDLM
KDATEQEKSEVLGKLQEIQNAYESALQKCGQRLIELEKSFVSRKYFKEDLDKACHWIKQA
DVLTYPEINLMNDDTELLALLSRYQQILEQAPEYENLLLSLQRTGQEILPSLDEVDHSYL
QEKHNSLPQQFNCVVGLAKEKLTKVQEAIYNRKEYASLIDLTSKAVKELEENFILIDKVP
SRISAEEVASLQHDFTSLLNEVLSLGTAINELNQKKEIFRSSGQPWLPEDMLQLTSQYYK
LKRVIEQKVSNLEDMTDAYWKHEDLCSKLNMKFETLSKELEQVNNETLPAEDKLKSYRSL
AANLKDAGVLHRHVVEHLEELSPMLEHAAYEKEDLQIKQWQEQLKSWHLVMKERMGECEN
RLVQSIDFQIEISRTLEWLRHLKVELHEPVVLDGKLENIQEEIRKLQLQQEETVSRLRII
NALGVREKKKYLKAKECVPVDLETSINSLSKLEEEVQDAINMKQTALDKMYSTSHRYHKV
LQSSLDWLKDAQELLQQITSGVDVEMAEESLKSVMEFISTENKFNGHVDELHILVSELED
FVQKSAQDQLKQSVATQKTKGKDTKEQIKAELDLLKRFTAQWHSYQEERQAVIMALNEVE
IKLSRFSVIKDVSGLKAEEKLLNHKSLVSLVNSFHEKITALEEKAAVIEKLGNDASKATV
CKSMTTVWQRWTRLRSTAREQEQVLEETVQEWKDLNDKIHQSTLMIDKLQEKLPENFTEK
ASKAELVELLENHEAFSRELEQEQTAITMLRQHAINGVLRGAETESVSLEDTPVMQEIKA
MQDRCANMQQKVKKSKKLVEQELKEREDVEKELNAVKTWIEETKDSLLNPSSEGDEYLQE
LKILQEELNSQRHKVEKLSDEQQSKYLEMYTILPSELSLLLAEVALALGTINEEIQARQR
EALHNQALHRGFSQQIKDMEEELKAILKKLKEKTSNLPCAKNDHKKLCETLDTCNIKLVE
LDAAVQDFAEQSHSQAKQLTDKVGKLTELHQQASQEAEHKAGKLKQAVIQLEEYNEMLEF
IQKWIEKAKILVHGHIIWTSASQLRDQSVTYQAMLEESRDIHSDLEAMNEKTEYLASVYC
TEGMALQVLDLGHQTEDLQQILRQRLQSLQDAAKDMKDFESEVRTLQTALEQAQTTLTSP
ELGRLSLKEQLSHRQHLLYKMESLKPKVQAVQSCQSALRIPEVGTSLPICRTALRLQEET
SRLQHMAIQQCNIMQEAVVQYEQYEQEMKHLQHLIEDAHRELQDTKVTTSNIQELQFQIK
RHEELAKKIKGYQEQIASLNSKCKMLTMKAKHATMLLTVTEVEGLAEGMEELDAELLPTH
SAHPSVVMMTAGRCHTLLSPVTEESGEEGTNSEISSPPACRSPSPVANTDASVNQDIAYY
QALSAEQLQTDAAKIQPNMSPPQEIYEPGLELAANAKLDDLQRSWETLKNVISEKQRTLY
EALERQQRYQDSLQSISTKMEAIEVKLNESLEPSKTPESQMAEHQALMDEIVMLQEEISK
LQASFADELVSESLDSDAADQLALQSTLTVLAERMATIRMKASGKRQLLEEKLNEQLEEQ
RHEQALQRYCGEADELDRWLLSTRATLDDILLAFEEPMDMEAQLIDCQNMLLEIEQKVVA
LSELSVHSENLLMEGKAHTKEEAEHLAIKLRTLKASLLELQRVLQDKQISIQENFYEKEE
SESVLSSSQSPSVQEWLVQSRTTRSLQKQNSLQRQKELEQELAEQKKLLQSVASRGGEII
NQQTATERPQLSENTDSLSRELGLEGFRSPLEDQMRMKWESLHQELSTKEKLVQNALEQE
KEQPIFSKTNRLVHGVPFYKGDRKAQDKSSVTKLLGGLNQSLEDASSQGGGVEKKSLPFE
RKLYDAVSATSSWLDDVEDQIFVATALQPEETEACLYHQETLAKDMKEMSEEMDKNKNLF
FQTFSRSGDNQEIIEDTLYCLLGRLNILESVVNHRCCQMKQRLQDLLAFQNDLKILFTSL
ADNKYIILQKLAEAAERPAKEQMQAILQAEDSLKELDTEINELKKRGDKLQANQSSVQEL
LKLQDTYDELMMIIGSRRSGLNQNLALKSQYERALQDLADLIETGTEKMSGGQKCSVSSR
EEVETLLDKHKEYFQGLESHVILTETLFRKICSYALPSESQHHSMLIAQASALLKQAHKR
GVELEYILEAWILLVGKYQELMKQLEVIESSIPTVGLVEETEERLLERIELFECFKSSLT
EYQPRLYQILEDGKRLLMSVNCPELEGLMSHLGEHWGNNANRVSKELQRLENILKLWTRY
KNESTELVNWLRSAIDRLEFWTQQSVTVPQELETVRDHLNAFLEFSKEVDAKSSLKSSVL
STGNQLLRLKKVDTASLRSDLTKIDTEWTELLIHIPVVQEKLHQLQMDKLPSRHAITEVM
TWISLMENVIKEDEENIRNVVGCEAIQEFLLKYKGFKIDVNCKQLTVDFVNQSVLQISSQ
DVESKRSDKTDFAEKLGAMNRRWQILQGLITEKIQMLERLLESWTEYGNSVNTLKSWFER
QEKKLQRHQSIGDQASVQNSLKECQELEDLIRVKEKEVEKVEQSGLSLIRDKKENVTAAV
LETLRELNHSWANLDHMVGQLKILLQSVLDQWSIYKEIYEELNSYLMEAKYSLSRFRLMT
GSMEAVKVQVENLKNLQEELEKKEDRLDKFGSVTNQLLNSCKSSLKDTLKTALKEVTTRW
NSLMEEISEQLHSSKTLLQLWQKYKDYSVQYNVTVQQQEDRANQLLKTATNKDIGDEEIT
IWIHDCSVLLKGLNTTKASLVSLSDIGEQLKQQVDTSATTAILSDHHSLNQRLSVLEQAL
LRQQAILQTGVLDYETFIKSLEDLETWIIESGEVLNGQDPNRSSDLSTIQERMEELKRQM
LRFSSMAPDLDRLNELGYRLPLNDKEIKRMQSLNRHWTVTSSQTTERFSKLQSFLLQHQT
FLEKCETWMEFLIETEQKLAVEISGNYQSLLEQQRAHELFQAEMFSRQQILHSIIVDGQR
LLEQGQVDDSDEFNLKLTLLSNQWQGVIRRAQQRKGIIDSQIRQWQRYREMAEKLRKWLV
EMSYQPVSGLGGIPIPLQQARNLLDEIQLKDKVLHRQQGSYILTVEAGKQLLLCADSVAE
AALQTELMDIQERWKATSVRLEEQKKQLAFLLKDWEKCEKGTAESLEKLRNFRKNLSHPL
PDHHDELHAEQMRCKELENAVEGWVEDLAFLTTLKEIFTQHITADDIAILNERIELLQRQ
WEELCHQVSLRRQQVSERLNEWAIFNEKNKELCEWLTQMESKVSQNGDISIEEMIEKLKK
DYQEEIAVARENKMQLQQMGERLAKASHESKASEIEYKLSKVNDRWQHLLDLIGARVKKL
KETLVAVQQLDKNMSSLRSWLGHIESELSKPIVYETSDSEEIQRKLNEQQELQRDIEKHS
TGVASVLNLCEVLLHDCDACATDTECDSIQQATRSLDRRWRNICAMSMERRLKIEETWRL
WQKFLDDFSRFEDWLTISERTAAFPSSSGVLYTVAKEELKKFEAFQRQVHESLTQLELIN
KQYRRLARENRTDSACKLKQMVHEGNQRWDNLQRRVTAILRRLKHFIGQREEFETARDSI
LVWLTEMDLQLTNIEHFSECDVQAKIKQLKAFQQEISLNNSKIDQIIAHGEQLIEKSEPL
DAAVIEEELDELRRYCLEVFGRVERYHKKLIRLPLTDDEHDFSDREVDVDEIADLTDIPW
HTKTAGGTLSPLPSSNHSLSLIVPMRSERSGRDTPASVDSIPLEWDHDYDLSRDLESAVS
QALCSDEEEQQDKKYFPQGATGITGEFGLETQIRQLDKALDTSRFHLQQTENVIRSSTPT
GPELDSSYMGYMKLLGECRESIDTVRKVSGKLKEEEEKISGFINLNSTESQSSGVIERWE
LIHAQALNKELRMKQKLQQWQQFISDFNNVWDWLGDTEEEVEQLNQLDVSTDIQAIEQRI
KKLKELQKAVDSRKAIVLSINLCSSEFTKANTPESKELQDRLKHMNVRWERLGSALEEWR
YKLQDALMQCQDFHEMSHGLLLWLENIDRRRNEILPINPDLDSDTLQDHLKLLSQMKREL
LESQLKVASLQDMSCQLLVNAEGKDCLEAKEKVHVIGNRLKVLLKEITRHIKDIEKILDI
SSNQLELTSWSSADELDTSGSLSPVSGRSTPSRQRTPRGKYSVSQPGPSVNNPPSRSKDD
GSGSYHSEANEAQRHQPFFLRVLRAALPLQLLLLLIIGLACLVPMTEEDYSCTLSNNFAR
SFHPMLRYTNGPPPI
Download sequence
Identical sequences F7BMN0
ENSXETP00000027049 ENSXETP00000027049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]