SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000027129 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000027129
Domain Number 1 Region: 156-210
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000315
Family PAPS sulfotransferase 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000027129   Gene: ENSXETG00000012409   Transcript: ENSXETT00000027129
Sequence length 210
Comment pep:known scaffold:JGI_4.2:GL172650.1:4792374:4794347:-1 gene:ENSXETG00000012409 transcript:ENSXETT00000027129 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARCWPGTILFSSKAPRKLVFLFTLSLSVTYLFYSLLNCYSSLQFPLQDATGGGVVGSAD
RGASGRETPSTSDSVSDQQKSSRIPSHSAAQDLEIHKVQTAKGIPGDNVALTAGYSAIHA
SVRKASISGSTEQETQESSTAEEELNRRFPVNSTPEYGEKKLPQAIIIGVKKGGTRALLE
ALRAHPDVRAVGVEPHFFDRNYEKGLEWYR
Download sequence
Identical sequences F6WUE5
ENSXETP00000027129 ENSXETP00000027129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]