SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000027495 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000027495
Domain Number 1 Region: 129-370
Classification Level Classification E-value
Superfamily vWA-like 1.11e-69
Family Integrin A (or I) domain 0.00000179
Further Details:      
 
Domain Number 2 Region: 1131-1314
Classification Level Classification E-value
Superfamily Fibronectin type III 1.44e-38
Family Fibronectin type III 0.0000124
Further Details:      
 
Domain Number 3 Region: 1526-1726
Classification Level Classification E-value
Superfamily Fibronectin type III 6.39e-32
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 4 Region: 994-1111
Classification Level Classification E-value
Superfamily CalX-like 1.19e-16
Family CalX-beta domain 0.0015
Further Details:      
 
Domain Number 5 Region: 631-715
Classification Level Classification E-value
Superfamily Integrin beta tail domain 2.35e-16
Family Integrin beta tail domain 0.0017
Further Details:      
 
Domain Number 6 Region: 30-80
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000837
Family Plexin repeat 0.0015
Further Details:      
 
Domain Number 7 Region: 545-582
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000053
Family Integrin beta EGF-like domains 0.032
Further Details:      
 
Domain Number 8 Region: 586-623
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000949
Family Integrin beta EGF-like domains 0.014
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000027495
Domain Number - Region: 505-545
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0019
Family Integrin beta EGF-like domains 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000027495   Gene: ENSXETG00000012556   Transcript: ENSXETT00000027495
Sequence length 1823
Comment pep:known scaffold:JGI_4.2:GL173181.1:495511:545137:1 gene:ENSXETG00000012556 transcript:ENSXETT00000027495 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMNPRVLGGLLLLVLLLGLPASHSQSNKYNPCVASRATSCSACIRAYKDCSYCADEGFAS
VRCDLAENLRRYGCSERGIVYMRSEVLTQQSYDINTLVSKTQVAPQRMSMRLRAGEETSF
DLNVFEPLDTPVDLYILMDFSHSMSDDLANLKNMGQELANVVSTLSKNYTIGFGKFVDKV
TVPQTDMRPEKLKQPWLDSTPPFSFKNVIQLTSDVGKFRNELMKEKISGNLDPPEGGFDA
ILQTAVCTNQIGWRKGSTHLLVFSTESAFHYEADGMNVLDGILKRNDEQCHLDASGYYTH
DIVQDYPSVPTLVRLLAKNNIIPIFAVTNYSYSYYDKLSKYFKVSEIGELKEDSSNIVEL
LQEAFTQIRSRMDIRDDNTPRAMDVSVTSETAKVTETGSFQVTRGEVGTFKVKVKALERL
GNQHVCELPPQDQGSQILLKPSTFTDGLKIDASLICDSCPCELQKELSSPKCSFNGDFVC
GRCECRERWRGVYCNCSSTDTKSTQSCISPGSTEICSGRGECLCGTCQCHSESPTQQYQG
EFCQFNNFQCPRFLGYMCNDRGRCHMGACVCDAGWEGESCQCPTSNQTCLDRNGGLCSSR
GKCVCGRCQCDNVSQYTDATCEFSYSLRQLGVCEDLRTCVQCQAWGTGEKKGTQCEACEI
KIKMVDELKKVDERSENCTFRDETDDCTYEYSVDPHAVQGNYTVLVKNKKECPPGAFLWL
IPLLIFLMLLLGLLLLLCWKYCACCKACLAMLPCCGPGRTVGFKEDHYMLRQSLMSSDYL
NTPLVRSGSLKGGDTVRWKIDNNVHRQPPAPGTLNPKELVPYGVSLRLARLFTENLSKPQ
SRECTQLRQEVEDSLNEVYKVIPGTHKVKQTAFRLQSNAGKRQDHTIAETILMAPREAEP
EIVKVTEKHVTQEAFQDMKVAPGYYTVTSDRDAHGLVEFQEGVELVDVRVPLFIREEDDD
EKQLLVEALDVPSGIARLGRKLVNITIIKEQAKSIVTFVKPAYTYSRQEQVARVPVSREI
IQNGKTQVTYRSKDLTAREGKDYTFSEGELTFQPDDTQSEILVPILGRSEVDTLLGNKQV
KQFLLELSNPKYGAKIGKYPQCTITIDDTAEDVIQKTMTVQSVQSPRGKVGAPINLNAQA
LSARKIRLNWMPPPGKPTGYKVRYWIQGDSESDATVVDTNVPSAELVNLYPYCDYEMRVC
AYNAQEEGPFTDIVTCQTLEEAPSEPGRLAFNVISSTVTQLSWAEPAETNGEITAYEVTY
GMVNEDNKPIGPTKKVLINDSKKRMVLIENLRESQPYRYTVRACNKAGWGPERDATMNLA
TQPTRPMSIPIIPDAPIIDAEAGEEYDSYLMYSTDVLRSPVGSKRPSVSDESGQRWKYVP
LLGSEMDLRRVTWKLPVEVIPRLSVSSGLSTDNESLLDQPLTTSSLTRKGTMRATPEGDR
IEQLINGRTEFSFSGGSLNRSMVSGYQQLSPHVQNESYRFGSSSSQHTSTTVISGQGQHF
QTTRGHLFSALCSEAEFTDTRLSPGIPDTPTRLVFSALGPTSLKVSWQEPQCEREVLGYK
VHYQLLHGGELRTIDITNPRENSVVVEDLLPNHSYMFRVKAQSVEGWGPEREGVITIESQ
VDPQSPLSPVPGSPFTLSTPSAPGPLVFTALAPDSLQLSWVRPRKPNGTILGYMITCEML
HGGGEPRTIYVEGDKPETSLTVPFLNENLPYKFKVQAKTTQGFGPEREGIITIESQDGGN
FSQFGTQQITRREVFNMPGEYTQSSITQSNITEPFFSDGMSVTTRRIEGSNTVTQQVTKE
FVTRTMMSGGSLNRQVERQFYDA
Download sequence
Identical sequences F7A9V4
ENSXETP00000027495 ENSXETP00000027495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]