SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000027532 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSXETP00000027532
Domain Number - Region: 13-101
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000111
Family Calponin-homology domain, CH-domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000027532   Gene: ENSXETG00000012584   Transcript: ENSXETT00000027532
Sequence length 836
Comment pep:known scaffold:JGI_4.2:GL173616.1:157966:187232:1 gene:ENSXETG00000012584 transcript:ENSXETT00000027532 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISLPLTEWVDVANSLLSKCHINLQVQEVSGCDARVFLALYEAILGEKVPDFIPDAQNPET
NAHNVQSVIDSLALDYLQVSLSHITGENIVRGDTESIQNLLEIFDGLLEYLTEQISEASS
QNGEDLDDRDFSQRRQNDEVPKAQEELLPTLRPPPLAGSPALSSEVFVPSWEVDGSESTA
ELIRLGDTAQTFTWRGLSLERATYVQREEEPVPKQPSVEGGEGLPQAPACVPSHRVGEGY
VAVNGFSVPGSHHEDLQPAIPLNRPYQPGRPPTADREAAGSGGPSHVHIQSHERLPSTGG
PQAPAVDSRQGKSPDGAETRDTHNGTSVSPFQKKVAFRTLPDIRLMTLHSTLTDCENGAL
AKEEELEQTDSTMQPEISERYSAPGSRHSLFETSSWATDTKLSSITEEPFSVQRARNRLS
EQELQEMSEKLSRKLDELDMPLHLSLSGTYXLLELRGVPYLGRVRCLCPCDTRGGGSLCS
GEQCNSCLYSLAQLLANDYEEQLKDLVQTERAQLSALKAKLKQTEEECEQNVCKEPKEKL
QPEMVYSAKRFVCTPKGSKVPALRTQPRKVARMKVKENDLLPLLLDEFPCLQISPHTLRR
MWQGQVSQMERLAKASQGDQRSERRLQIEVEEAQKKQDLLVDIIRKEQGQNQRLKEFRER
IGLQKSAQNRMKERRQQAVRARRYYEDYHVQLRAKLMRARTREERLFKKLFEEGLELQKE
RLREIRSYTREQRLEQRKRHKDELDSMENYYKDQFSMLADAVTQERQQIQAQEQAQAKTL
QKIKRELRGKMEKEIRDLQEMIIRTDEDAFFRDLEAERLRRRLQMASYQYSKSHCM
Download sequence
Identical sequences F6VZ55
ENSXETP00000027532 ENSXETP00000027532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]