SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000027724 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000027724
Domain Number 1 Region: 110-354
Classification Level Classification E-value
Superfamily vWA-like 4e-77
Family Integrin A (or I) domain 0.000000651
Further Details:      
 
Domain Number 2 Region: 355-442
Classification Level Classification E-value
Superfamily Integrin domains 4.24e-19
Family Integrin domains 0.0016
Further Details:      
 
Domain Number 3 Region: 5-61
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000303
Family Plexin repeat 0.0036
Further Details:      
 
Domain Number 4 Region: 517-557
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000067
Family Integrin beta EGF-like domains 0.0043
Further Details:      
 
Domain Number 5 Region: 602-672
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.000000693
Family Integrin beta tail domain 0.0057
Further Details:      
 
Domain Number 6 Region: 483-518
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000391
Family Integrin beta EGF-like domains 0.016
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000027724
Domain Number - Region: 564-599
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000153
Family Integrin beta EGF-like domains 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000027724   Gene: ENSXETG00000012671   Transcript: ENSXETT00000027724
Sequence length 762
Comment pep:known scaffold:JGI_4.2:GL172862.1:1392129:1412290:1 gene:ENSXETG00000012671 transcript:ENSXETT00000027724 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISVADVCKHTGSCNECILSSASCSWCNAKNFTKSGESEGLRCAVRAELLSRGCDKDHIID
PHGSVNVLQGQPLSESADQESVIQLHPQAINVKLRPEGEQRKFRVEFKRAEGYPIDLYYL
MDLSYSMKDDLENMKKLGSDIKKALHKVTKSVHIGFGCFVDKTVLPFVSTVKSKLENPCP
LRGEKCQPPFSYRHVLSLTSNLTLFQMRVSAENISGNLDMPEGGLDAMLQAAVCTDVIGW
RNVTRLLVFASDDVFHSAGDGKLAGIYLPADGHCHLNRNAEYSQSYLYDYPSVGHLVQVL
TAANIQPIFAVTSSVVSTYKALSNLIPKSAVGELKEDSSNVVNLISEAYNNLSSTINLEH
VNLPKGIHISYDSHCSNSSTLGKAQGQCSGVRINQTVSFDVTLWMDKTLCQQGKQSFQLR
VLGFTEELKVDVEPLCACDCKDKELFSDYCSRGLGNYSCGICSCLEGHSGKHCECPLEKH
NNDKACWSNSHLLCSGHGRCQCGRCACDVSFRGDLCQCDDTSCERFEGKLCGGITRGVCE
CGTCKCSDGYTGSACGCSTDTSGCRTNDTLCSGHGSCECNKCKCHPGYYNKWCSECPECQ
TICKKLTNCAECKAFGKGFLKHNCSSSCQNINVTLAKAPLTGVREKLCKEKGEDFITFLV
REEGDFFHVTVEEKQETAPVTKHLILDLTLGIVFIGLIIILAFSITVEIYDRQEYNRFQK
ERSNAQWNELNNPLYKSATTTVKNPHFIEYVRPNVVLVSHSD
Download sequence
Identical sequences F6VXM1
ENSXETP00000027724 ENSXETP00000027724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]