SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000028414 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000028414
Domain Number 1 Region: 5-479
Classification Level Classification E-value
Superfamily Sema domain 1.83e-160
Family Sema domain 0.00000000129
Further Details:      
 
Domain Number 2 Region: 475-527
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000262
Family Plexin repeat 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000028414
Domain Number - Region: 555-609
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00826
Family C1 set domains (antibody constant domain-like) 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000028414   Gene: ENSXETG00000012967   Transcript: ENSXETT00000028414
Sequence length 796
Comment pep:known scaffold:JGI_4.2:GL172658.1:2990043:3001620:1 gene:ENSXETG00000012967 transcript:ENSXETT00000028414 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSPERSFKTFEADGVTYFTTLLLGKDGSALYVGAQEALFSLNSTDFTSADYHSKIAWQAD
EEKKKECAFKGKDPQRDCQNYIKILLQLNSTHLYTCGTFAFSPTCTYIKISDFSLEKNAL
GHPILEDGKVRCPFDPEYNSTAIMVDGEMYAGTVSNFQGNEPIIYKSHDSRITLKTENSL
YWLQDPAFVGSAYIQESLPKGNPVGDDDKIYYFFSETGKEFDFFENTIVSRIARVCKGDL
GGERVLQRRWTSFLKAQLICSCPGDGFPFNVLKDMFVLTPGEEHWKSTIFYGVFTSQWNK
GGAGSSAVCAFSMDEVQNAFNGLFKEVNRETQQWYTYTNSVPEPRPGACITNSARDKKIN
SSLQMPDRVLNFVKDHFLMDSAIRSQPLLLQSQIRYQQISVQRVRGLKKTYDVLFLGTDD
GRLHKAVSVNKMVHIIEEIKLFQDMQPVQELLLDPSKGLIYASSRSAVVQVPVSNCSMYR
SCGECILSRDPYCAWNKKGCHSVPHHTHDTKNQHWVQDIEDANTDAHCKPSNSTEAIGRA
GKPDVESECQEISMESNPANTLPCKLLSNLASRVWLHNGKEIDSSYFVLPSGDLILVSSP
DRVGTYECWSVEEGFRKLMVRYCVGTQEGIKATTTQRTETEKKIVNASSVSSFPSNTAKL
TGKSYWMEFVIMSTLFGIMVVILGLLLLYRNRKEMKSILKPVEHSDKPPKKLRKNGMPAE
SLPLNGTNVPSPAADHKGYQTLNDNYIISTPIHDPVIATESEKRPLSITRDTYVEVSPAC
QRPRVRLGSEIRDSVV
Download sequence
Identical sequences F6Q156
ENSXETP00000028414 ENSXETP00000028414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]