SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000028544 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000028544
Domain Number 1 Region: 393-498
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.89e-30
Family Calponin-homology domain, CH-domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000028544   Gene: ENSXETG00000013029   Transcript: ENSXETT00000028544
Sequence length 1177
Comment pep:known scaffold:JGI_4.2:GL173109.1:728243:925356:-1 gene:ENSXETG00000013029 transcript:ENSXETT00000028544 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AHSWQPGIKNPYRGVVVWPVPENVEITVTLFKDPHAEEFEDKEWTFVIENESSSGRRKAL
ATSNINMKQYASPMPTQTDVKLKFKPLSKKVVSATLQFSLSCIFLREGKATKSDEDMQSL
ASLMSMKQADIGNLDDFEEDNEEDEENRVNQEEKTAKITEIVNQLNALSNLSEDQDACIK
QPHLPSAKSSTPCEELINKLNFLDEEERDLMNSSSNPFESSDVADFNPFGDPDAEENPSE
QAPSKSDDLFDDYNPFKEPEPAVYINPFDEPDTEQDQVLELSKDSPPQPAKRKNTRPVDM
SKYLYANKARQEEEDLDESNPFYEPKENLNVSQRTGVKEFDPEKKVKRKAPGPPMPSPKR
EEPARAPLAVPAGKDIAPSPKPSPLPSPTLGRQPNASQSLLAWCKEVTKSYRGVKITNFT
TSWRNGLAFCAILHHFRPDLIDYKSLNPQDIKENNKKAYDGFASIGISRLLEPSDMVLLA
IPDKLTVMTYLYQIRAHFSGQELNVVQIEENSSKSTYKVGDYETDTNSSIDQEKFYAELH
DLNQEAGPELEEAPSKLPDFLPHDGSALVHDNGILDKQSMASSAVESISAEMDFTCTRTR
SNLELQSPSRTFEYEKSSQCESSNEAYSEAQPLVTQRKLLKVDTTDLTDPCEVIEPRKEN
ISFGTTSGAHQQQSLADQPNPGSFTSTPQSGVDSIPKEKVYSQCYSVHSGDSNGKVGDFT
FKAPPLPQTAISSLIDSAKVSSNNSDQPSKSTEQRMLSRQEELKERARILLEQARKDAAL
KAGNKQRNNMSAPTRAKQLSDQQDEERRRQLRERARQLIAEARSGVKMSELPSYNEMSTE
KFKDRAKASGDEPDFNKALTNEESPDPTLVCGGGEPSNTDTDSTDLAGQNSHSVDVKLKR
LLEAQPQVANSLSNAAQKISPEATDRDFKNGAQDTRSERLQKAPDRFKNPVVFNKDSTVR
KTQLQSFSQYVESRPEMKRQRSMQEDTKRVNEEVVITETQKKPSEDEVLNKGFKDTSQYV
VGELAALENEQNQIDTRAALVEKRLRYLMDTGRNTEEEEVMMQEWFMLVNKKNALIRRMN
GLSLKEKEHDLERRFELLNRELRAMLAIEDWQKTEAQKRREQLLLDELVILVNKRDALVR
DLDAQEKQAEEEDEHLERTLEQNKGKMAKKEEKCAIQ
Download sequence
Identical sequences F6QNC9
ENSXETP00000028544 ENSXETP00000028544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]