SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000028548 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000028548
Domain Number 1 Region: 402-507
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.44e-28
Family Calponin-homology domain, CH-domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000028548   Gene: ENSXETG00000008426   Transcript: ENSXETT00000028548
Sequence length 1125
Comment pep:known scaffold:JGI_4.2:GL172782.1:574850:633565:1 gene:ENSXETG00000008426 transcript:ENSXETT00000028548 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSVWKRLQRTGKRASRFQFVASYQELKLECTQKWQPDKVVVVWTRRNRRVCSKPHSWQP
GIKDPFRGSVVWAVPENVDITATLYRDPHTEYFEEKEWTFQIEGESRGHKKLLAAAPIDL
RKFASISAAPREVILPLSPRSVKVVSATLVVSIASSLIREGKATDDDMQSIASLLSLKPS
DIADMEDFNEEDEEEKSRQIRSPTGTGMRGELIHKDNISHESERDQVGVVSRVRDRPDSI
ELNTLAEEEDETPINTTNFASQTTTKSPSNVYQSSNNVIPPRRPQEFNPVPLDKSNNSVT
NFKGEEQDQVTLRDKERSQQLHQEDEKTEEEEWDKEKAKYTKSEVKMSEQIENRRSDKDK
QKEEHIAKETTTSCTEETVPWKESLQKAPETSPIENESIGEKLNTTDTLLHWCQEVTGGY
RGVRVNNFTTSWRNGLAFCAILHHFHPEFINYDVLDPLNIKENNKKAFDGFAGLGIPALL
CPTDMLLRPIPDKLIILTYLCQIRDHFISQKREVIDTQVTEAEFFSSKEKSMASTTTEET
KIQKSTVAKSISPEDLNANISPGLKKLITKSPKVEKQEKSSLDREDKVNVSTLEEKEKQR
FSFTEQKMPGSGKDKQGPSSGDKSKPKETSQDLTINDEHKTANQTSPKHEAQSSSTNDAV
IPPPRIKKRLSVNGGSNECDSNLEQVDASVSSSSTPVPPPRKGGGLGHLRDADLVKKRRS
LIRTQSLSEEVDITQKIHETDSRPSSEIINAHHYLYTISGFRSTYMSGLEPLISKDFCLL
LHQIEVFTFQSKQYLEDISHKQMNFLMNRTGSIFFTETPPSMHTTSVPSSVPTTEVKVKE
EETPENVPYNINNIVEVVPPNRISAFSQPQRDNTKQEYRSSLTVFKLKTFTFNFQSPVAL
LCMHTKIRKKQNTLFVPYTKRLKPGGRAPITVNNVQSRGQEGDAYVLPSIHPSLTECLLL
SLRDTSQYVTSELAALELEQRNVDERASVVEKDLRSLMENGSDKEAEETLIQEWFSLVNR
RNALIRRQDELQLLVEEQDLERRFELLSRDLRGLLCIEEFMKSEAQKKREKLLLDELVSL
VNQRDGLVRDLHFKGIRAFEEDERIERSLEQRRRKLSKKEKCRIS
Download sequence
Identical sequences F6QLK4
ENSXETP00000028548 ENSXETP00000028548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]