SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000029438 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000029438
Domain Number 1 Region: 103-345
Classification Level Classification E-value
Superfamily vWA-like 1.09e-64
Family Integrin A (or I) domain 0.000000962
Further Details:      
 
Domain Number 2 Region: 347-432
Classification Level Classification E-value
Superfamily Integrin domains 5.07e-20
Family Integrin domains 0.0019
Further Details:      
 
Domain Number 3 Region: 2-59
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000167
Family Plexin repeat 0.00084
Further Details:      
 
Domain Number 4 Region: 551-589
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000781
Family Integrin beta EGF-like domains 0.0055
Further Details:      
 
Domain Number 5 Region: 508-545
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000781
Family Integrin beta EGF-like domains 0.029
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000029438
Domain Number - Region: 475-507
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0019
Family Integrin beta EGF-like domains 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000029438   Gene: ENSXETG00000013431   Transcript: ENSXETT00000029438
Sequence length 727
Comment pep:known scaffold:JGI_4.2:GL172688.1:945862:978875:-1 gene:ENSXETG00000013431 transcript:ENSXETT00000029438 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ENRCSSSSATTCAKCLALGPECGWCTQEDFMMDSTENERCDTALNLKSKGCRQDSIEYPT
AHAQPLSSRDTNSQVTPAEVSVHIRPAKLGAKVNFMLKVHHLRKYPLDIYYLVDISASMH
KSIARLNSVGFDLSQKMANFSDDIKYGFGSFVDKPVSPYISVHPQKIKNQCSVVDLVCMP
PHGYINVLPLTYNTTKFKNVVGKQRIAGNIDNPEGAFEAMLQAAVCNTDIGWRKEARHLL
ILMTDQTSHLALDSKLAGIVTPNDGSCHLKDNVYIRSSDMEYPSLGLLGEKLTENHISGV
FAVQGLQFNWYKDLLPLIPGTTARQLDPFASNMKNLVFDAYKMLLSEVKIEVDNPIKGIH
VHVTSICPDGTRRSGKEGCQNVKANEKVFFNVTLTMDSCDVHNGRDYIVLRPLGFNETAI
IKVHRDCTCQCNSVSQAKGKCVTDDSTDCQTTPCKEEICSSDELDSASESCRASPSQPVC
SGRGVCLCGKCFCQKTKLGAIYGKYCEKDTFSCPYHHGKLCSGNGDCEDGKCRCFNGWES
DRCHCASSLRKHCMNSKGLVCSGRGVCQCGKCECTDAKSFGPLCQYCTGIYSTFLKNRNC
EHFQGSANVSEPEGNLYETACALLVYYIDQTSECFSDPRILTLFFIISIVTFLLGILTVL
LTRHIILHHHKTRDRSSPSYRTPTNKKDKSVLHNVYTRTVTYTREKPEDINIDIRKMEAP
ETIKCNF
Download sequence
Identical sequences F7BYS1
ENSXETP00000029438 ENSXETP00000029438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]