SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000031041 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000031041
Domain Number 1 Region: 85-194
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.96e-33
Family Calponin-homology domain, CH-domain 0.001
Further Details:      
 
Domain Number 2 Region: 2021-2157
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000152
Family Extended AAA-ATPase domain 0.083
Further Details:      
 
Domain Number 3 Region: 2049-2096,2167-2250
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000617
Family Adenosine-5'phosphosulfate kinase (APS kinase) 0.094
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000031041
Domain Number - Region: 1832-1860
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0183
Family Mitotic arrest deficient-like 1, Mad1 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000031041   Gene: ENSXETG00000014194   Transcript: ENSXETT00000031041
Sequence length 2386
Comment pep:known scaffold:JGI_4.2:GL173180.1:595422:698267:-1 gene:ENSXETG00000014194 transcript:ENSXETT00000031041 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSILVASKMKSGLPKPIHSAAPILHVPARTIPQPCYIKLGNRAEVSKHAFPSQTPLKPQ
PAYDSSGDGHLIMKSHSTEGGFDTQIYTDWANHYLAKSGHKRLIKDLQQDVTDGVLLAEI
IQVVANEKIEDINGCPKNRSQMIENIDTCLSFLAAKGINIQGLSSEEIRNGNLKAILGLF
FSLSRYKQQQSQKQPQQYQPAPQLYQPPSTPHAQPHPAAPLQCQQPQQPPHPQTKAQADM
HSRLPAPSARAMAAGTENKSRGQTGGSRRSQSFNNHEKAKPLNSPATVPVSSEASTCWFR
AQLGPVIAHCMPCLRLGATKGGHWLCSTEAPREIVSGVITLPYGGGEISHQTNSPGPPLP
LAYTLTPGPRTPLHINLLLASQGHSQAWAQPLPTIAWEPLGPSPICTANGKGPEMSALSN
GAPSVSPSNSVIPCAEPSVWDTRCHYIPVGKRRAKCGRNDTECGHRIPALGNSRSRAQRG
FVSSASFLLTGPLPSPLALTCPYPQYEGSDWAVTVEAADKFGSFNWTPGSPRIWETQRSG
SVTYNDFLPSVPDGGLGLYTRRLNRLPDGMAAVRETLQRNASAGQGDADRETRAPRGDAA
PHKHIIDSQYLSRGANGRQQGGGGGNISLLLSLPGLLLSLPGLLSIHSLLLKSQADPEGG
VSVETSSGGINMDSALYNKTGPPCLEDLSGEDPETRRLRTVKNIADLRQNLEETMSSLRG
TQITHSTLETTFDSNVTTEISGRGILGLTARPTPLSWRLGQSSPRLQAGDAPSLGNGYPP
RANASRFINCEPGRYVYSAPLRKQLASRGGNIGHMDVSDKGGDVMDIEGVSIDAGGYMSD
GDVLSKNIRSDDITSGVGLGADGGADTQLRSLNKLPFAQRFAQSTMCALTPVSLSCSWDD
SSSVSSGISDTIDNLSTDDINTSSSISSYANTPASSRKNLDVQTDTEKHLHIDRNSLWSG
DEVKRSDGGSDSGMKMDSGSKWRKNPSDLSDESDKSTSGRKTTVISQTGSWRRGMTAQVG
ITAPRTKPSAAGLKAPGTGKTDDAKASEKGRLSPKAAHIKRSPSDAGRSSGDEAKKPPNT
SRAIPTNTFGFKKQGGTVVGIPIVTASGATITSGSATLGKMPKSSGLIGRSNRKANADGS
QNQDDGYLQINSRTNLQYRSLPRPSKSRSGTGNRSSTSSIDSNISSKSAGLPIPKLREPG
KVTLGHSVPGLVNQTDKEKGISSDNESVASCNSIKMTPASQAACNGSRQQQGNKYPDVSS
PTLRRLFGGKPNKSLTTENMKNSMVISNPHATMNSQANPDSPSGSAILSSGGSSPLYVKS
MDHSPLASSPGSAHSAPSNSLTWGTTASSSSAVSKEGFQSVSSLHTSCESIDISLSSNNS
PGALTASSREDTMAPFVRTNSIKTTLSERLPAPSPPGASPKFSRNTLPRKQDSDLCLDRN
TLPKKGLRCAPSCQIRSQDEAKEWLRSHSSGGLQDTANNSPFSPGASITSPSGTRFNFSQ
LASPTGTSQMCLSNQTMLRAHSLSNADGCGDPYGESRFRNSSMSLDEKSRTMSRSGSFRD
GFEEVHGSSLSLVSSTSSVYSTPLRSDSLKPGKLCEGFNCFQSPYPDILLSVPPQAHLVA
AFEQSLSNMTIRLQSLTMSAEQKDSELNELRKTIDMLKKQNAAAQAAINGVINTPELGCK
AGNGTSQPPDLRIRRQHSSDSVSSINSATSHSSVGSNVDSDSKKKKRKNWVNELRSSFKQ
AFGKKKSPKSASSHSDIEEMTDSSLPSSPKLPHNGSALSTPRLRGSHSSSLISEFTENEA
ESVMQLRNELRDKEMKLTDIRLEALSSAHQLDQLRESMNRMQSEIEKLKSENDRLKAENN
GKCSRTQSQVSLSSCSPRQSMGPSQLSLSLTESSSLDMLLDDAAADGTMRKESRHVRIVV
NLSEEMKWREDARPRLFLIGCIGVGGKTKWDVLDGVVKRLFKEYIIHVDPVTQLGLNSDS
VLGYSIGDIKRVGNAETPELLPCGYLVGENNTICVTVRGLAQSSLDCLVFETLTPKPILQ
RYISLLMEHRRIILSGPSGTGKTYLANRLAEYLVQWEGRELAEGVIATFNVDHKSSKELR
QYLSNLADQCSNENSSADTPLVIILDNLHHVGSLGEIFNGLLNCKYQKCPYIIGTMNQAT
SSTPNLQLHHNFRWVLCANHTEPVKGFLGRYLRRKLIETEINSRTRNPELVKIIDWIPKV
WQHLNKFLETHSSSDVTIGPRLFLSCPIDVDGSRVWFTDLWNYSIIPYLLEAVREGLQLY
GRRAPWEDPARWVMETYPWTAVPQQHEWPPLLQLRPEDVGFDGYSVPREGTSSKQAAPSD
AEGDPLMNMLMRLQEAANYSSPQSYDSDSNSNSHQDDLDTSLESTL
Download sequence
Identical sequences F7C2C2
ENSXETP00000031049 ENSXETP00000031041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]