SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000031240 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000031240
Domain Number 1 Region: 30-262
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.59e-80
Family Calponin-homology domain, CH-domain 0.000092
Further Details:      
 
Domain Number 2 Region: 1044-1155
Classification Level Classification E-value
Superfamily E set domains 3.34e-36
Family Filamin repeat (rod domain) 0.0000056
Further Details:      
 
Domain Number 3 Region: 1533-1641
Classification Level Classification E-value
Superfamily E set domains 1.8e-33
Family Filamin repeat (rod domain) 0.00000477
Further Details:      
 
Domain Number 4 Region: 1331-1446
Classification Level Classification E-value
Superfamily E set domains 1.6e-32
Family Filamin repeat (rod domain) 0.0000306
Further Details:      
 
Domain Number 5 Region: 1425-1543
Classification Level Classification E-value
Superfamily E set domains 1.93e-32
Family Filamin repeat (rod domain) 0.0000466
Further Details:      
 
Domain Number 6 Region: 456-572
Classification Level Classification E-value
Superfamily E set domains 2.34e-31
Family Filamin repeat (rod domain) 0.00048
Further Details:      
 
Domain Number 7 Region: 1146-1250
Classification Level Classification E-value
Superfamily E set domains 2.2e-30
Family Filamin repeat (rod domain) 0.0000416
Further Details:      
 
Domain Number 8 Region: 1858-1953
Classification Level Classification E-value
Superfamily E set domains 8.01e-30
Family Filamin repeat (rod domain) 0.00000774
Further Details:      
 
Domain Number 9 Region: 859-969
Classification Level Classification E-value
Superfamily E set domains 8.67e-30
Family Filamin repeat (rod domain) 0.00024
Further Details:      
 
Domain Number 10 Region: 2042-2136
Classification Level Classification E-value
Superfamily E set domains 3.72e-29
Family Filamin repeat (rod domain) 0.0000185
Further Details:      
 
Domain Number 11 Region: 1241-1352
Classification Level Classification E-value
Superfamily E set domains 1.73e-28
Family Filamin repeat (rod domain) 0.0000171
Further Details:      
 
Domain Number 12 Region: 2234-2326
Classification Level Classification E-value
Superfamily E set domains 3.87e-28
Family Filamin repeat (rod domain) 0.0000058
Further Details:      
 
Domain Number 13 Region: 656-765
Classification Level Classification E-value
Superfamily E set domains 2.4e-27
Family Filamin repeat (rod domain) 0.00043
Further Details:      
 
Domain Number 14 Region: 746-869
Classification Level Classification E-value
Superfamily E set domains 8.01e-27
Family Filamin repeat (rod domain) 0.00095
Further Details:      
 
Domain Number 15 Region: 378-477
Classification Level Classification E-value
Superfamily E set domains 2.2e-26
Family Filamin repeat (rod domain) 0.00057
Further Details:      
 
Domain Number 16 Region: 1630-1743
Classification Level Classification E-value
Superfamily E set domains 5.16e-26
Family Filamin repeat (rod domain) 0.0000499
Further Details:      
 
Domain Number 17 Region: 2425-2517
Classification Level Classification E-value
Superfamily E set domains 1e-25
Family Filamin repeat (rod domain) 0.00000939
Further Details:      
 
Domain Number 18 Region: 277-374
Classification Level Classification E-value
Superfamily E set domains 8.67e-25
Family Filamin repeat (rod domain) 0.001
Further Details:      
 
Domain Number 19 Region: 2553-2644
Classification Level Classification E-value
Superfamily E set domains 4.54e-24
Family Filamin repeat (rod domain) 0.0000115
Further Details:      
 
Domain Number 20 Region: 2332-2423
Classification Level Classification E-value
Superfamily E set domains 5.8e-24
Family Filamin repeat (rod domain) 0.0000174
Further Details:      
 
Domain Number 21 Region: 571-665
Classification Level Classification E-value
Superfamily E set domains 9.34e-24
Family Filamin repeat (rod domain) 0.00014
Further Details:      
 
Domain Number 22 Region: 957-1064
Classification Level Classification E-value
Superfamily E set domains 7.34e-22
Family Filamin repeat (rod domain) 0.0013
Further Details:      
 
Domain Number 23 Region: 2155-2247
Classification Level Classification E-value
Superfamily E set domains 5e-21
Family Filamin repeat (rod domain) 0.0000221
Further Details:      
 
Domain Number 24 Region: 1955-2039
Classification Level Classification E-value
Superfamily E set domains 7.34e-19
Family Filamin repeat (rod domain) 0.0000614
Further Details:      
 
Domain Number 25 Region: 1796-1873
Classification Level Classification E-value
Superfamily E set domains 9.34e-18
Family Filamin repeat (rod domain) 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000031240   Gene: ENSXETG00000014268   Transcript: ENSXETT00000031240
Sequence length 2645
Comment pep:known scaffold:JGI_4.2:GL172911.1:714891:755456:-1 gene:ENSXETG00000014268 transcript:ENSXETT00000031240 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSAHSRLSTQSGGAGGAVPGEAAEMPATEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNK
RIANLQVDLGDGLRLIALLEVLSQKKMYRKYNQRPTFRQMQLENVSVALEFLDRENIKLV
SIDSKAIVDGNLKLILGLIWTLILHYSISMPMWDEEEDEEAKKQTPKQRLLGWIQNKLPH
LPVTNFSRDWQSGRALGALVDSCAPGLCPDWDSWDATKPVDNAREAMQQADDWLGIPQVI
TPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKLNPKKARAYGPGIEPTGNMVKKRA
EFTVETISAGMGEVLVYVEDPAGHREEAKVTANNDKNRTFSVYYIPKVTGLHKVTVLFAG
QHIAKSPFEVNVDKSHGDASKVTAQGPGLEPSGNIANKTTYFEIFTAGAGVGEIEVTIVD
PNGKKDTADVQLEDKGSSTYRCTYKPTMEGVYTIYITFAGVQIPKSPYTVTIGQACNPAA
CRAVGRGLQPKGVRVKETADFKVYTKGAGSGELKVVVKGPKGTEERVKQKDLGDGVYAFE
YYPATPGNYIVTITWGGQNIPRSPFEVKVGTECGQQRVRAWGPGLEGGVVGKSADFVVEA
IGDDVGTLGFSVEGPSQAKIECDDKGDGSCDVRYWPLEPGEYAVHVLCNNEDIKLSPFMA
DIKPAPKDFYPEKVKAYGPGLEKTGLAINKPAEFTVDAKLGGKAPLKVSVQDSEGTPVDV
TTKDNGNGTYSCSYLPKKPLKHTAVVSWGGVNIPNSPFRMTIGAGSHPNKVKVYGPGVAK
TGLKAHEPTYFTVDCTEAGQGDVSIGIKCAPGVVGPAEADIDFDIIRNDNDTFTVKYTPP
GAGSYTIMVLFADQATPMSPFRIKVDPSHDASKVKAEGPGLNRSGVEIGKPTHFTVNTKA
AGKANLDVQFTGPAKGEAVKDFDVIDNHDNTYTVKYTPVQQGNMGVNVTYGGDHIPKSPF
TVGIAPTLDLSKIKVSGLGDKVEVGKDQEFTVKSRGAGGQGKVACKITGPSNKSVPCKVE
PGLSPDNSTVKFIPREEGPYEVDVTYDGVPIPGSPFPVEAVPSTNPSKVKAFGPGLKGGS
VGSSAPFTIDTKGAGQGGLGLTVEGPCEAKIECLDNGDGTCSVSYLPTERGDYNINILFA
DTHIPGSPFKAKVEPCFDPSKVTCSGPGLEHAQVGEAGKFNVDCSNAGSAELTIEIISDN
GMQAEVHIQDNGDGTYTITYIPLYPGVYTITIKYGGQMVPNFPSKLQVKPAIDTSGVKVY
GPGVEGKGVFREATTDFNVDARALTKSGGPHLKTVVSNPSGNFTEAFVQDNGDGTYKVEY
TPYEEGIHSVDVIYDGSPAPKSPFVVPVTEGCDPSRVRVHGPGIVSGTTNQPNKFTVETS
RGAGTGGLGLAVEGPSEAKMSCTDNKDGSCSVEYVPYEPGTYNLNVTYGGHQVPGSPFKV
PVSDVVDSSKVKCTGPGLSPGLVRANVPQSFSVDTSKAGVAPLQVKVQGPKGIVEPVEIV
DNGNGVQTVNYVPTREGPYNISVLYGDDEIPHSPFKVRVLPTHDASKVKASGPGLNTTGV
PASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKATIRDNQDGTYTVSYVPDMTGRYTILI
KYGGDEIPYSPYRIRALPTGDASKCTVTVSIGGHGLGAGIGPTIQIGEETVITVDAKAAG
KGKVTCTVCTPDGTEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHIPNSPFQVTA
LDGEQMMPQQMVQQQLAPPYAYPGMQQPWATDRPVMGVNGLDVAGLRPFDLVIPFTIKKG
EITGEVRMPSGKVAKPDITDNKDGTVTVRYAPTEAGLHEMDIKYDGMHIPGSPLQFYVDY
VNSGHVTAYGPGLIHGTVNKPAVFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTCTV
SYLPVLPGDYNILVKYNNKHIPGSPFVAKITGDDSMRMSQLKVGSAADIPLNIVETDLSQ
LTATVTSPSGREEPCLLKRLRNGHVGISFVPKETGEHIVSIKKNGIHIPNSPITVMISQS
EIGDASRVIVSGQGLTEGRTFEPAEFIIDTREAGYGGLSLSIEGPSKVDINTEDLEDGTC
KVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGEGRMKESITRRRTAPSVANIGSQCDL
SLKIPEISIHDMTAQVTSPSGKIHDAEIMESENNTYCIRFVPSEMGVHTVSVKYKGQHVP
GSPFQFTVGPLGEGGAHKVRAGGPGLERAEVGTPAEFSIWTREAGAGGLSIAVEGPSKAE
IAFEDRKDGSCGVSYIVQEPGDYEVSVKFNDEHIPDSPFVVPVGSTSDDARRLTVSSLQE
SGLKVNQPASFAVSLNGAKGVLDAKVHSPSGALEECCVTEIDEDKYAVRFIPRENGLYIV
DVKFNGSHIPGSPFKIRVGEPGQAGDPGMVSAYGPGLEGGTTGSAAEFIVNTTKAGPGAL
TVTIDGPSKVKMDCQECAEGYKVTYTPMAPGSYLISIKYGGPYHIVGSPFKAKVTGPRLV
TSHSLHESSSVFVDSVTKSEAFTQHAAAPRIASDASKVVAKGLGLNKAFVGQKNSFTVDC
SKAGNNMLLVGVHGPKTPCEEIVVKHLGNRLYNVTYLLKDKGDYILVVKWGDEHILGSPY
HVSVP
Download sequence
Identical sequences F6R7N1
ENSXETP00000031240 ENSXETP00000031240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]