SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXETP00000031328 from Xenopus tropicalis 76_4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXETP00000031328
Domain Number 1 Region: 1-128
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.02e-33
Family Calponin-homology domain, CH-domain 0.00096
Further Details:      
 
Domain Number 2 Region: 1866-2001
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000419
Family Extended AAA-ATPase domain 0.072
Further Details:      
 
Weak hits

Sequence:  ENSXETP00000031328
Domain Number - Region: 1894-1941,2030-2092
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000336
Family Nucleotide and nucleoside kinases 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXETP00000031328   Gene: ENSXETG00000014323   Transcript: ENSXETT00000031328
Sequence length 2229
Comment pep:known_by_projection scaffold:JGI_4.2:GL172796.1:463527:568040:1 gene:ENSXETG00000014323 transcript:ENSXETT00000031328 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QIYTDWANHYLTKSGHKRLIKDLQQDIADGVLLAEIIQIIANEKIEDINGCPKSQSQMIE
NVDVCLNFLAVRGVNVQGLSAEEIRNGNLKAILGLFFSLSRFKQQQHQQQQYYQSLVELQ
QHVTHSSSSSETSQPKTLDMQSSLTARYATQSNHSGIATNQKKTTRLPGPSRVPAAGSST
KGQGTANLNRRSQSFNSIDKNKPPHYANGNEKESPKGPQQSAGMNGNVQYSTSSGQQVAS
AIPSPSASKPWRSKSMNVKHSATSTMLSVKQPSPATSPTPSSDRLKPPLSEGSKTSSSAQ
KSMLEKFKLNSRGSLRSQSSSNEVIREDDTLSECGENDSGSSFNSPKVSPKLAPPKAGSK
NISNKKCLPQPKDKDDKNRDKNKSEKAAKEEKEQTSEGSKKSSKIASLIPKGNKTAAVKK
DSMIPLSSGIPKPGSKVPAAKQTTSPGSAAAKEPEKNRTTKGSQTQLTQKTSASEKATTP
LEGKTPSSSAGPGNGTVQLPQQQYTHPNTATVAPFIYRTHTENDSTLVPPADSCTSPTKG
ESSYSKTAKQCLEELSGEDPETRRMRTVKNIADLRQNLEETMSSLRGTQITHSTLETTFD
STVTTEVSGRNLPSLTSRSSAMTWRLGQASPRLQAGDAPSLVGAYPRNNPSRFIHTDPSR
FMYTTPLRRAGISRLGNISQVEISEKGSHDLDIASEVDVGGYMSDGDILGKSLRSDDINS
GYLTDGGLSLYTRSLNRIPDLAASRDVIHRGVHDVTVDADSWDDSSSASSGLSDTLDNLS
TDDLNTSSISSYTNVAPTRKNNQTQSKTDAEKRSLTDCEPWCNDDIKKQDEDFDIPLDTS
GKWKSGFSEESDKAGQKSLSVSQTGSWRRGMTAQIGTTSPRQKSGSSSLKTPGKTDDVKA
SEKVKSPLKGNTLQRSPSDAGKSSGDEGKKPPSGIARPTATGSFGFKKAGMASPSMVTGS
GATINSGSATLGKIPKSSCIGGKGAGRKTSLDGSQNQDDTVLLGNSKAALQYRSLPRPSK
SSTSGIPGRGGHRSSTSSIDSNVSSKSAGASSTKLREPSKIGSGGSSPVIINQTDKEKEK
VSDSESVSLSSSPKSSPTSVNACGTQGLRQPGSKYPDIASPTFRRLFGSKAGNKPSSTGS
TDGGKTTSVMPSPSSTSLARQGSLDSPSSGTGSMGSAGGQSGSSSPLFSKANELIPDVIS
YGQSLATSPASVHSFTSGGQVWTANLSSSSAGSKDTPSYQSMTSLHTSSESIDLPLSHHG
SLSGLSTQEAQSLLMRTGSVRSTLSESMQLDRNTLPKKGLRYTPSSRQTSQEEGKEWLRS
HSTGGLQDTGSQSPLVSPSGMPSSATGKYHYTNLVSPTNLSQFSIPGPSMMRSNSIPAQD
SSFELYEDSQLCGSAISLEERPRAISHSGSFRDSMEEVHGSSLSLVSSTSSLYSTAEEKA
HSEQIQKLRRELVASQEKVATLTSQLSANSHLVAAFEKSLGNMTGRLQSLTMTAEQKSFY
FIDLCDTVLFWFSSYLSNSYFSVSFNKISSSPLLLSARVSQGSVLIPILNSFTTHNIPEL
FTEPIQRLSFQSWTLRSSFKQAFGKKKSNKPPSSHSDIEELTDSSVPSSPKLQHNGDDAG
SLSLKLSQSSTDICECTEAEAEIILQLKGELREKELKLTDIRLEALSSAHHLDQIREAMN
RMQNEIEILKAENDRLKAETSSPGKTVRPSSESSSCTSSSSRQSLGLSLNNLNVSDHSTA
ADNILDDMRDGAFQKEGRSVKIVVSINKGFGRRKDAKSRFYLIGSIGVSGKTKWDVLDAV
IRRLYKEYIYRVDPAANLGLTSDSISSYCIGDIVRANNSEVPEMLPCGYLVGANNTITVN
LKVGLEENSLDSFVFDTLIPKPITQRYINLLMEHHRIILSGPSGTGKTYLANKLAEYVIN
KSGRKKIEEAVATFNVDHKSSKELRQYLANLADQCSADNDIDLPLVIILDNLHHIGSLSD
IFNGFLNCKYSKCPYIIGTMNQSISSSPNLELHHNFRWVLCSNHTDPVKGFLGRCLRRKL
IETEIEQNMRNNDLIKIIEWIPKAWHHINGFLETHSSSDVTIGPRLFLSCPMDVDGSKIW
YTDLWNYSVIPYLLEAVREGLQMYGKRAPWEDPSKWVLETFPWSTSSSQQESPALLQLRP
EDVGYDGYATAKEGTTSKNVSQSEKEGDPLMNMLMRLQEAANFSSAQSCDSDSTSHHDEI
LDPSLESTL
Download sequence
Identical sequences F6YVA0
ENSXETP00000031328 ENSXETP00000031328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]